(data stored in SCRATCH zone)

EMBL: AM420293.PE680

AM420293.PE680       Location/Qualifiers
FT   CDS_pept        763071..763742
FT                   /transl_table=11
FT                   /gene="cvnD6"
FT                   /locus_tag="SACE_0693"
FT                   /product="ATP/GTP-binding protein"
FT                   /function="predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0693"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00035"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L1"
FT                   /protein_id="CAM00035.1"
FT                   /translation="MDSVGYRAQQAGATPPQPQSSRGTTSAKIVVAGGFGVGKTTFVGS
FT                   VSEIVPLTTEAVMTEASRGVDDLAATPNKTSTTVAMDFGRISLDSDLILYLFGTPGQQR
FT                   FWFMWDDLVRGAIGAVVLVDTRRLADSFSAVDFFEDRGLPYLIGVNCFDGQLMHSIEQI
FT                   REAMAIGPDVPIGPCDARDKESTKQTLIALVQHAMRWWTAKQMPPGSQQPPGSPQQPPM
FT                   R"
     gtggactccg tcggctatag agcgcagcag gccggtgcga cgccgccgca accgcagtcg        60
     tcgcggggca cgacctcggc gaagatcgtc gtcgccggtg gcttcggcgt cggcaagacg       120
     accttcgtcg ggtcggtctc cgagatcgtg ccgctgacca ccgaggcggt catgacggag       180
     gccagccggg gggtcgacga cctggcggcc acgccgaaca agaccagcac cacggtggcc       240
     atggacttcg gccgcatctc gctggactcg gacctgatcc tgtacctgtt cggcacgccc       300
     gggcagcagc ggttctggtt catgtgggac gacctggtgc gcggtgcgat cggtgcggtc       360
     gtgctcgtcg acacccggcg gctcgcggac tccttctccg cggtcgactt cttcgaggac       420
     cgcggactgc cttacctgat cggcgtgaac tgcttcgacg ggcagctcat gcactcgatc       480
     gagcagatcc gggaggccat ggccatcggg ccggacgtgc cgatcgggcc gtgcgacgca       540
     cgggacaagg agtcgaccaa gcagacgctg atcgccctgg tccagcacgc catgcggtgg       600
     tggacggcga agcagatgcc gcccggctcg cagcagcccc cgggctcgcc gcagcagccg       660
     cccatgcgct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page