(data stored in SCRATCH zone)

EMBL: AM420293.PE682

AM420293.PE682       Location/Qualifiers
FT   CDS_pept        complement(765395..766219)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0695"
FT                   /product="protein of unknown function DUF574"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0695"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00037"
FT                   /db_xref="GOA:A4F7L3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L3"
FT                   /protein_id="CAM00037.1"
FT                   /translation="MPNTDETSIPHVDTSQPSIARVYDAFVGGKDNFEVDRVVYRKILE
FT                   IAPEAAEVGKQCRAWLIRVVRFLSGQAGIDQFLDLGSGLPTAENTHQAAQRLNPEARVV
FT                   YIDNDPSVAAHGRALLEENDRTHFAVADLREPADLLADPIVTSNLDLTRPVALIQCNTL
FT                   HHVTDDERPADIMRAYVDALAPGSYVAISHLFNPADGSDRAQLAEDSQKRFNAMMGSCY
FT                   YRRREEIEELFCGLEMVEPGLSYLFDWWPDGPRLTPPAPGAHNLLGGVARKN"
     atgccgaaca ccgacgagac ctccatcccg cacgtcgaca ccagccagcc cagcatcgcc        60
     agggtgtacg acgcgttcgt ggggggcaag gacaacttcg aggtggaccg ggtggtctac       120
     cggaagatcc tggagatcgc cccggaggcc gccgaggtcg gcaagcagtg cagggcatgg       180
     ctgatccgcg tcgtgcgctt cctgtccggg caggcgggca tcgaccagtt cctcgacctg       240
     ggctccggcc tgccgaccgc ggagaacacc caccaggccg cgcaacggct caaccccgag       300
     gcgcgcgtgg tctacatcga caacgacccg tcggtcgccg ctcacgggcg ggcgctgctg       360
     gaggagaacg accgcaccca cttcgcggtc gccgacctgc gcgagccggc cgacctgctg       420
     gcggacccga tcgtgacgtc gaacctcgac ctcacccggc cggtcgcgct gatccagtgc       480
     aacaccctgc accacgtcac cgacgacgag cggcccgccg acatcatgcg ggcctacgtc       540
     gacgcgctcg ccccgggctc ctacgtcgcc atctcgcacc tgttcaaccc ggccgacggc       600
     agcgaccgcg cccaactcgc cgaggactcg cagaagcgct tcaacgccat gatgggcagt       660
     tgctactacc ggcgccggga ggagatcgag gaactcttct gcggcctgga gatggtcgag       720
     cccggcctca gctacctctt cgactggtgg cccgacggtc cgcgcctcac cccgccggcc       780
     cccggcgcgc acaacctgct cggcggcgtc gcgcggaaga actga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page