(data stored in ACNUC1104 zone)

EMBL: AM420293.PE683

AM420293.PE683       Location/Qualifiers
FT   CDS_pept        complement(766308..767402)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0696"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0696"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00038"
FT                   /db_xref="GOA:A4F7L4"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7L4"
FT                   /protein_id="CAM00038.1"
FT                   /translation="MAVDVLSARDLNRATLHRQLLLERSTRTPVEAVEHLVGMQAQVPI
FT                   PPYFGLWTRLDGFAPDDLAQRLLDRSLVRIVLMRSTVHLVTADDCLTLRPLMQPPIDRD
FT                   LARNHPVGVEHREIAAYGRKLLDEKPRTLAQLRPLLAERWPQEDPARLGYAVRSLLPLV
FT                   QIPPRAVWGRSGQPTYATAETWLGRQLDPVPSLEDVVRRYLAAFGPATVADVQTWSGLI
FT                   GLRELVRGLGLRVFRDEHGRELFDLPDAPRPEPDVPAPPRFLPPYDNVLLSHADRTRIM
FT                   TERHRKLLFGANSGVFPGTVLLDGFVRGTWEISRQGTTAVLHVRPLARLSRRDSAALEA
FT                   EGRGLLGFAEESAEQHEVRFGAAE"
     atggcagtcg acgttctctc ggcacgcgac ctcaaccggg ccacgctgca ccggcaactc        60
     ctgctcgaac gctcgacgcg tacaccggtc gaagccgtgg agcacctggt cggcatgcag       120
     gcgcaggtgc ccataccgcc ctacttcggg ctctggacgc gactcgacgg tttcgccccc       180
     gacgacctcg cgcaacggct gctcgaccgc agcctcgtgc ggatcgtgct catgcgcagc       240
     acggtccacc tggtcaccgc cgacgactgc ctcaccctgc ggccgctcat gcagccgccg       300
     atcgaccgcg acctcgcccg caaccacccc gtcggcgtgg agcaccggga gatcgcggcc       360
     tacgggcgca agctgctcga cgagaagccg cggaccctcg cgcagctccg gccgctgctg       420
     gccgagcggt ggccgcagga ggaccccgcc cgcctcggct acgcggtgcg cagcctgctg       480
     ccgctggtgc agatcccgcc gagggcggtc tggggcagga gcgggcagcc gacctacgcc       540
     accgccgaga cctggctcgg caggcagctc gacccggtgc cgtcgttgga ggacgtcgtc       600
     cgtcgctacc tggccgcgtt cggacccgcc accgtcgccg acgtgcagac gtggtccggc       660
     ctgatcgggc tgcgggagct cgtgcgcggt ctgggcctgc gggtgttccg cgacgagcac       720
     ggacgcgagc tgttcgacct gcccgacgcg ccccggcccg aaccggacgt gcccgctccg       780
     ccgcgcttcc tgccgcctta cgacaacgtg ctgctctccc acgccgaccg cacccggatc       840
     atgaccgagc ggcaccgcaa gctgctgttc ggcgcgaaca gcggggtttt ccccggcaca       900
     gtgctgctcg acggcttcgt gcgcgggacc tgggagatca gcaggcaggg caccaccgcg       960
     gtcctgcacg tccggcctct ggctcggttg tccaggaggg actccgccgc tctggaggcg      1020
     gaaggccgtg ggctgctcgg cttcgccgag gagtcggccg agcagcacga ggtgcgcttc      1080
     ggcgcggccg agtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page