(data stored in ACNUC1104 zone)

EMBL: AM420293.PE689

AM420293.PE689       Location/Qualifiers
FT   CDS_pept        complement(771389..772339)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0702"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00044"
FT                   /db_xref="GOA:A4F7M0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7M0"
FT                   /protein_id="CAM00044.1"
FT                   /translation="MEQRHPDIGRWSGRLQELAEATGLSLRQLSEHVPWSPSTLSRYLS
FT                   GERVVDEAWLLASKLIDLAHRRGTPVDVRSDELHLLYQQARKAYQQQRRSARGKADQVG
FT                   ESAATAPTSSDVGLPERPAEQPVVASSGQPNATEPATDSSEQPNATPPAPSPDTPATAT
FT                   SEQSDAAPEPPSSPDARPARRSRRPFVLALATAVAVAAVAAAVWASLLWLRPQTVVWRA
FT                   NIVGTWSAQHQQHLGVFRFRTPDVPGDTDKATYHEGTAVSIVCQARHRRVVSDPTTGQS
FT                   SPVWNRLSDGYWIPDLYTDLPKVTGEAPPLGIPLC"
     ttggaacagc ggcaccccga catcgggcgg tggtcggggc ggctccagga actcgccgag        60
     gcgaccggac tgtcgctgcg ccagctctcc gagcacgtgc cgtggtcgcc gtcgacgctg       120
     tcgcgctacc tcagcggcga gcgcgtcgtg gacgaggcgt ggttgctggc gtccaagctc       180
     atcgacctgg cgcaccggcg cgggacgccc gtcgacgtcc ggtcggacga actgcacctg       240
     ctctaccagc aggcgcgcaa ggcctaccag cagcagcggc gatcagcccg cggcaaagcc       300
     gaccaggtgg gcgaatccgc tgcgaccgca ccaacatctt ccgacgtggg cttaccggag       360
     cgtcccgccg aacagcccgt cgtggcttcc tccggacagc ccaacgcaac tgagcccgct       420
     acggactctt cagagcagcc caacgcgact ccacccgcgc catcccccga tacgcccgcc       480
     acggccacct ccgagcagtc cgacgccgca cccgagccgc ccagctcccc cgacgctcgc       540
     ccggcgcgca ggtcccgccg cccgttcgtg ctggccctcg cgaccgcggt cgccgtcgcc       600
     gccgtcgccg cggcggtgtg ggcctcgctg ctgtggctgc gcccgcagac cgtggtctgg       660
     cgcgccaaca tcgtcgggac ctggtcggcc cagcaccagc agcacctcgg cgtcttccgc       720
     ttccggaccc ccgacgtccc cggtgacacc gacaaggcca cctaccacga gggcaccgcg       780
     gtctccatcg tctgccaggc ccggcaccgg cgcgtggtct cggacccgac caccgggcag       840
     tcctcaccgg tctggaacag gctcagcgac ggctactgga tccccgacct ctacaccgac       900
     ctgccgaagg tgaccggcga ggcaccgccg ctgggcatac ccctgtgctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page