(data stored in ACNUC1104 zone)

EMBL: AM420293.PE69

AM420293.PE69        Location/Qualifiers
FT   CDS_pept        94800..95108
FT                   /transl_table=11
FT                   /locus_tag="SACE_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99424"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V0"
FT                   /protein_id="CAL99424.1"
FT                   /translation="MEIANMRRAKLVPRWRGKRALRSAQVLDDVVNAQVALLPQLSPEA
FT                   RQRSADHLAEMVMLGQAYRHYAAGWISRRELERRGKAALRRMESTKRPPLEQLTERE"
     atggagatcg cgaacatgag gcgggcgaag ctggtcccga ggtggcgtgg caagcgggcg        60
     ctgcgctcgg cgcaggtgct ggacgacgtg gtgaacgctc aggtcgcgct gctcccgcag       120
     ctctcgccgg aggccaggca gcgcagcgcc gaccacctgg cggagatggt catgctcggc       180
     caggcgtacc ggcactacgc ggcgggctgg atcagccggc gcgaactcga gcgccgcggc       240
     aaggccgcgt tgcgccgtat ggagtcaacc aagcggccac ctttggagca actcaccgaa       300
     cgtgagtga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page