(data stored in SCRATCH zone)

EMBL: AM420293.PE693

AM420293.PE693       Location/Qualifiers
FT   CDS_pept        775113..775514
FT                   /transl_table=11
FT                   /locus_tag="SACE_0706"
FT                   /product="putative Streptomyces subtilisin inhibitor-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0706"
FT                   /db_xref="EnsemblGenomes-Tr:CAM00048"
FT                   /db_xref="GOA:A4F7M4"
FT                   /db_xref="InterPro:IPR000691"
FT                   /db_xref="InterPro:IPR023549"
FT                   /db_xref="InterPro:IPR036819"
FT                   /db_xref="UniProtKB/TrEMBL:A4F7M4"
FT                   /protein_id="CAM00048.1"
FT                   /translation="MRAAIRLTGRLAVASIVFAVAALIPLGANAETGPTKVTLTAQQLG
FT                   APLSVAVLTCEPSGGTHPRAEDACAVMSATGGMIEEMPAQNPQALCPLIWRPVGVTATG
FT                   LWNGKPIEYAKTFANDCVMRSQLGVVFDF"
     ttgagggctg caatccggct caccggccgc ctggccgtcg caagcatcgt gttcgccgtc        60
     gcggcgctga tcccgctcgg cgcgaacgcc gagaccggcc ccacgaaggt gactctcacc       120
     gcccagcagc tcggcgcgcc gctcagcgtc gccgtgctca cctgcgagcc cagcggcggt       180
     acgcacccgc gcgccgagga cgcgtgcgcc gtaatgtcgg ccaccggcgg catgatcgag       240
     gagatgcccg cccagaaccc gcaagcgctg tgcccgctga tctggcgtcc cgtcggcgtc       300
     accgccaccg ggctgtggaa cggcaagccg atcgagtacg cgaagacctt cgccaacgac       360
     tgcgtgatgc gttcccagct gggagtcgtc ttcgacttct ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page