(data stored in SCRATCH zone)

EMBL: AM420293.PE71

AM420293.PE71        Location/Qualifiers
FT   CDS_pept        complement(96483..97013)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0073"
FT                   /product="probable copper resistance protein"
FT                   /function="uncharacterized protein, homolog of Cu
FT                   resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99426"
FT                   /db_xref="GOA:A4F5V2"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V2"
FT                   /protein_id="CAL99426.1"
FT                   /translation="MRRFVAVAALSLTALLGGAGTALAHNVLIGSDPTEGAQLEVGPQQ
FT                   VRLTFDQPVRAGEGYNTVNVVGPDGTYWTDGAVQVDGTSVTAPVRQLGPAGTYTVGYRI
FT                   LSADGHPVPGKVTFTLTKPGGGTPAQPPQAQQEQQSAESGGMPVWPWVLGAVVLVGVGL
FT                   TLALRMGRPTGKN"
     atgaggcggt tcgtcgcggt cgcggcgctg tcgctcaccg cgctgctcgg cggggcgggc        60
     accgccctcg cgcacaacgt gctgatcggc agcgacccca ccgagggcgc gcagctggag       120
     gtcggcccgc agcaggtgcg gctgaccttc gaccagccgg tccgggccgg ggagggctac       180
     aacacggtca acgtcgtcgg accggacggg acgtactgga ccgacggcgc ggtgcaggtc       240
     gacggcacgt cggtcaccgc accggtgcgg cagctcggac ccgcgggcac ctacaccgtc       300
     ggctaccgga tcctgtccgc cgacgggcat ccggtgccgg gcaaggtcac cttcaccctg       360
     accaagccgg gcggcggcac gccggcccag ccgccccagg cccagcagga gcaacagtcg       420
     gccgagtccg gcggcatgcc ggtctggccg tgggtcctcg gcgcggtcgt gctggtcggc       480
     gtcggcctga cgctcgcact gcggatgggc aggcccaccg gcaagaactg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page