(data stored in SCRATCH zone)

EMBL: AM420293.PE78

AM420293.PE78        Location/Qualifiers
FT   CDS_pept        102966..103961
FT                   /transl_table=11
FT                   /locus_tag="SACE_0080"
FT                   /product="possible glycine betaine/carnitine/choline
FT                   binding protein precursor"
FT                   /function="glycine betaine/choline-binding (lipo)protein of
FT                   an ABC-type transport system (osmoprotectant binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99433"
FT                   /db_xref="GOA:A4F5V9"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5V9"
FT                   /protein_id="CAL99433.1"
FT                   /translation="MNRRTALKLMSAGMAGMLVGGCGLSSGSAVPLPVAPGSIRPVPEL
FT                   EGVRITVGSKDFTEQIVLSYIAQFALDAAGANVRDLSNITGSASARNALASGQIDVLWE
FT                   YTGSSWISYNGNTDPIPDARRQYEAVRKLDLERNGIDWTAVTFDVDNTYAFAMTQEAAK
FT                   RLGVSKLSDVRRVVAENPQDATFCVDTEFASRNDGMPGVEQTYGFRADPAKIKTLTSGS
FT                   IYQATASGTCTFGEVFTTDGRIRSLNLKVLDDDRLFFPRYNLGVTLRADMLRQYPQITD
FT                   VLAPVSAQLNNVELMKLNAQVDVEGRDPADVARDWMVEKGFVTLPGRAAP"
     ttgaaccgtc gaaccgcgct caagctgatg tcggcaggca tggccgggat gctggtcggc        60
     ggctgcgggc tcagctccgg ttccgccgtg ccgctgccgg tcgcgcccgg ctcgatccgc       120
     ccggtccccg agctggaggg cgtgcggatc acggtggggt ccaaggactt caccgagcag       180
     atcgtgctga gctacatcgc ccagttcgcg ctggacgccg ccggagccaa cgtccgcgac       240
     ctgagcaaca tcaccggctc ggccagcgcg cgcaacgcgc tggccagcgg ccagatcgac       300
     gtgctgtggg agtacaccgg ctcgtcgtgg atcagctaca acggcaacac cgacccgatc       360
     cccgacgccc gccggcagta cgaggcggtg cgcaagctcg accttgagcg caacgggatc       420
     gactggaccg ccgttacctt cgacgtggac aacacctacg ccttcgcgat gacgcaggaa       480
     gcggcgaagc ggctgggtgt gagcaagctg tcggacgtcc ggcgcgtcgt ggccgagaac       540
     ccgcaggacg ccaccttctg cgtggacacc gagttcgcca gccgcaacga cggcatgccc       600
     ggggtggagc agacctacgg gttcagggcc gatccggcca agatcaagac cctgacctcg       660
     ggcagcatct accaggcgac ggccagcggc acctgcacct tcggcgaggt gttcaccacc       720
     gacggccgca tccgctcgct gaacctgaag gtgctcgacg acgaccggct gttcttcccc       780
     cgctacaacc tcggggtcac cctgcgcgcc gacatgctgc ggcagtaccc gcagatcacc       840
     gacgtgttgg cgccggtgtc ggcgcagctg aacaacgtcg agctgatgaa gctcaacgcg       900
     caggtcgacg tcgagggccg cgacccggct gacgtcgccc gcgactggat ggtggagaag       960
     ggcttcgtga ccctgcccgg gcgggccgcg ccgtag                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page