(data stored in SCRATCH zone)

EMBL: AM420293.PE79

AM420293.PE79        Location/Qualifiers
FT   CDS_pept        complement(104011..104319)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99434"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W0"
FT                   /protein_id="CAL99434.1"
FT                   /translation="MRAGFRFRHLPDADDVHALQGFRVLSGAMDVYLARAADDALGARY
FT                   RLEDLQGPSPAALWHRHGTVAEVVTALLELPEHGTPKAPKLAHARPDGLWVPHGANP"
     gtgcgggcgg gcttccgctt ccgccacctg cccgacgccg acgacgtcca cgccctgcag        60
     ggtttccggg tcctgtccgg cgcgatggac gtctacctcg cccgtgccgc cgacgacgcg       120
     ctcggcgccc gctaccggct cgaagacctc caagggccga gtccggcggc gctgtggcac       180
     cggcacggca cggtcgccga ggtggtgacc gcgctgttgg aactccccga gcacggcacg       240
     ccgaaggctc cgaagctcgc ccacgcccgg ccggacggcc tttgggtgcc gcacggcgcg       300
     aacccctga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page