(data stored in ACNUC1104 zone)

EMBL: AM420293.PE8

AM420293.PE8         Location/Qualifiers
FT   CDS_pept        13104..13919
FT                   /transl_table=11
FT                   /locus_tag="SACE_0010"
FT                   /product="hypothetical protein Rv0007"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99363"
FT                   /db_xref="GOA:A4F5N9"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5N9"
FT                   /protein_id="CAL99363.1"
FT                   /translation="MTPSEKPGESASQSKDASHTSVITQSEEATESTAERGTPAAEDQA
FT                   PNHGEEAAALDGTDAPPPWQRGAATSSAGEQPSWPTEQPVGTSGSPADAGGAPDSEDTQ
FT                   KIPRPAQEQETARNEVPQSSSGGRTAVTFGSAGRATTAAGSARRPSRGPRRASLQVKRV
FT                   DPWSVLKLALVLSVALFFVWMIAVAVLYGVLDGMGVWDQLNGTFTELTQPDDAAAEPLI
FT                   SAGRVFGVASIIGAINIVLITALATVAAFIYNVAADFAGGVEVTLSERE"
     gtgacacctt ccgagaagcc gggggaatcg gcatcgcagt ccaaggacgc gagccacacc        60
     tcggtcatca cgcagtccga agaagccacc gagtccaccg ccgagcgggg gacgccggcc       120
     gctgaggacc aggcaccgaa ccacggcgag gaggccgccg cgctggacgg caccgacgca       180
     ccgccgccgt ggcaacgtgg tgcggcaacc tcctcggccg gtgagcagcc ctcctggccc       240
     acggagcagc cggtggggac ctccgggtcc ccggcggatg ccggcggagc gccggactcc       300
     gaggacaccc agaagatccc gcggcccgcg caggagcagg agaccgcccg caacgaggtc       360
     ccgcagtcgt cctcgggcgg ccggaccgcg gtgaccttcg ggtccgccgg gcgggccacc       420
     accgccgcgg gcagcgccag acgtcccagc cggggaccga ggcgggccag cctgcaggtc       480
     aagcgggtcg acccgtggtc ggtgctcaag ctcgccctgg tgctgagcgt ggcgctgttc       540
     ttcgtgtgga tgatcgcggt ggcggtgctc tacggcgtcc tggacggcat gggcgtctgg       600
     gaccagctca acggcacgtt caccgagctg acccagcccg acgacgcggc cgccgagccg       660
     ctgatcagcg cgggccgggt gttcggcgtc gcctcgatca tcggggcgat caacatagtg       720
     ctcatcacgg cgctggcgac ggtggccgcg ttcatctaca acgtggccgc cgacttcgcc       780
     ggtggcgtcg aggtgacgct gtccgagcgg gagtga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page