(data stored in ACNUC1104 zone)

EMBL: AM420293.PE84

AM420293.PE84        Location/Qualifiers
FT   CDS_pept        complement(108471..109115)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99439"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W5"
FT                   /protein_id="CAL99439.1"
FT                   /translation="MRRSAKKRARSPRLGCTRTAGRSHKALWMAEPADRADKRATRSQK
FT                   QRTKALKRQIKAEEKRLELQERGEGGRVTAGNAKKVIAVARVVVPVLAPFALRASVAVR
FT                   AYYDRMRARRLGVPVDDLGRFTGKGAALHARIAGDRDALRDIRTQTVGRSEEEVFAVDQ
FT                   YAEETDGRLGQLASAVRAAERMPAQRRRAAHRAIDGELKRLEGHLLRRLGV"
     atgcgcaggt ccgcgaagaa gcgcgcgagg tcgccgaggc tcggctgcac ccgcaccgcc        60
     gggcgctcgc acaaggcgct gtggatggcc gagccggcag accgggcgga caagcgcgcc       120
     acgaggtcgc agaagcagcg gaccaaggcg ctgaagcggc agatcaaggc ggaggagaag       180
     cggctggagc tccaggagcg cggcgagggc ggccgggtca ccgcgggcaa cgcgaagaag       240
     gtcatcgcgg tggccagggt cgtcgtgccg gtgctcgcgc cgttcgccct gcgggcgtcg       300
     gtggccgtgc gcgcctacta cgaccggatg cgtgcccggc gcctgggcgt gccggtcgac       360
     gaccttggcc gcttcaccgg caagggcgcc gccctgcacg cgcggatcgc gggcgaccgc       420
     gacgcgctgc gcgacatacg cacccagacg gtcgggcgca gcgaggagga ggtcttcgcc       480
     gtcgaccagt acgcggagga gaccgacggc aggctcgggc agctcgcgag cgccgtccgg       540
     gccgcggagc ggatgcccgc gcagcgccgc cgggccgcgc accgggcgat cgacggcgag       600
     ctcaagcggc tggagggcca cctcctgcgg cggctcgggg tgtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page