(data stored in ACNUC1104 zone)

EMBL: AM420293.PE86

AM420293.PE86        Location/Qualifiers
FT   CDS_pept        complement(110943..111611)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99441"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W7"
FT                   /protein_id="CAL99441.1"
FT                   /translation="MARKKPEWPEENAGTVRKYANRFDHEGALETLDMIRDELFGDSEA
FT                   MEALARQWGSDNTMTDSGLEIQRASNELAGYWQGGGYDAYTKHEFAVRGLFTNNETQMN
FT                   GISDVMLDCVELIYGTYADALRFISSCAHDLVSFSLADLIPGAGTIVKIIQVLNDFVKN
FT                   VSDLVAAAIEKMGTLMVKKGKLTTFANDFSGLGTDTGGPLVMPGAAGNPDAWNVKPIEA
FT                   "
     atggcgcgca agaagcccga gtggccggag gagaacgccg gcaccgtgcg caagtacgcg        60
     aaccggttcg accacgaggg tgcgctcgaa acgctcgaca tgatccgcga cgagctgttc       120
     ggtgactccg aggcgatgga ggcgctggcc aggcagtggg gctcggacaa cacgatgacc       180
     gactccggcc tggagatcca gcgggcgtcc aacgagctgg cgggctactg gcagggcggc       240
     ggctacgacg cctacaccaa gcacgagttc gcggtgcgcg ggctgttcac caacaacgag       300
     acgcagatga acggcatctc cgacgtgatg ctggactgcg tcgagctgat ctacggcacc       360
     tacgccgacg cgctgcggtt catctcgtcc tgcgcgcacg acctggtgtc gttcagcctg       420
     gccgacctga tcccgggcgc gggcaccatc gtgaagatca tccaggtgct caacgacttc       480
     gtgaaaaacg tctccgacct ggtggccgcc gccatcgaga agatggggac gctgatggtg       540
     aagaagggca agctgaccac cttcgccaac gacttctcgg ggcttggcac cgacaccggc       600
     ggaccgctgg tcatgcccgg cgccgcgggc aacccggacg cctggaacgt caagccgatc       660
     gaggcgtag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page