(data stored in ACNUC1104 zone)

EMBL: AM420293.PE87

AM420293.PE87        Location/Qualifiers
FT   CDS_pept        complement(111623..111985)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99442"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5W8"
FT                   /protein_id="CAL99442.1"
FT                   /translation="MPGQVEGTGYSVVPESLRGTTTAWEESRDRWLLLASRMETEFYMP
FT                   DNAMGLLGREQNFPRTYNEARATIGRKLAEGADVLGGTSTDLDRVADEYEDRDYEYYKK
FT                   FGYLNDEMDDRVSGSF"
     ttgcctggtc aggtggaagg aacgggctac tcggtagtcc cggagtcgct gcgcgggacc        60
     acgaccgcgt gggaggagtc gcgggaccgg tggctgctcc tggcgtccag gatggagacc       120
     gagttctaca tgcccgacaa cgccatgggg ctgctcgggc gggagcagaa cttcccgcgg       180
     acctacaacg aggcgcgggc gacgatcggg cggaagctgg ccgagggcgc cgacgtcctc       240
     ggcggcacca gcaccgacct cgaccgcgtg gccgacgagt acgaggaccg cgactacgag       300
     tactacaaga agttcggcta cctcaacgac gagatggacg atcgcgtcag cggttcgttc       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page