(data stored in ACNUC1104 zone)

EMBL: AM420293.PE89

AM420293.PE89        Location/Qualifiers
FT   CDS_pept        complement(112312..112632)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99444"
FT                   /db_xref="GOA:A4F5X0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5X0"
FT                   /protein_id="CAL99444.1"
FT                   /translation="MDNSRYDPDLRREQLQRWQRKAAELEYYAERLAEERFTGTSDSGL
FT                   VTAEVDGNGRLLDISVSDEALEQAHPQNIGPDAVEAIAQARATAAVTAMSWTESVVGEV
FT                   SA"
     atggacaaca gccgatacga ccccgacctg cgtcgggagc aactccagcg gtggcagcgc        60
     aaggcggccg agctggagta ctacgccgag cgcctcgccg aggagcgctt caccggtacc       120
     tccgacagcg gtctggtcac cgccgaggtc gacggcaacg ggcggctgct ggacatctcg       180
     gtctccgacg aggcgctgga gcaggcgcac ccccagaaca tcggcccgga cgccgtcgag       240
     gccatcgcgc aggcgcgggc gacggcggcg gtgaccgcga tgtcgtggac ggagtcggtc       300
     gtgggggagg tctcggcatg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page