(data stored in ACNUC1104 zone)

EMBL: AM420293.PE9

AM420293.PE9         Location/Qualifiers
FT   CDS_pept        14150..14266
FT                   /transl_table=11
FT                   /locus_tag="SACE_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99364"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5P0"
FT                   /protein_id="CAL99364.1"
FT                   /translation="MKKLIALAVVAGAVLFVVRRNRAAKAEADLWREATAEA"
     gtgaagaagc tgatcgcact cgccgtggtt gctggtgccg ttctgttcgt cgtccgccgc        60
     aaccgcgccg ccaaggccga ggccgacctc tggcgcgagg ccaccgcgga agcctga          117
//

If you have problems or comments...

PBIL Back to PBIL home page