(data stored in ACNUC1104 zone)

EMBL: AM420293.PKNJ

AM420293.PKNJ        Location/Qualifiers
FT   CDS_pept        581313..582575
FT                   /transl_table=11
FT                   /gene="pknJ"
FT                   /locus_tag="SACE_0526"
FT                   /product="serine/threonine kinase"
FT                   /function="15 Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99872"
FT                   /db_xref="GOA:A4F748"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4F748"
FT                   /protein_id="CAL99872.1"
FT                   /translation="MSEDLTGRRLGHYKIDAVLGRGGMSVMYRATDTRLGRKVALKVMG
FT                   EHITGDAEFRERFVDEARNTSAIDHANIVPLYDFGEVDGMLYIAMRLVDGSDLASKIKD
FT                   GPISAQRTLELLGQVAEALDMLHERNLVHLDLKPANVLVTSRESSSEHVYLADFGLTRR
FT                   GATGHRTSSGDFLGSPTYAAPEHLRGEPVDGRTDLYALACMLFACLTGRPPFQGQVQEV
FT                   IQGHLHGEPPKVTSLVVLPADIDDVLRRGMAKKADQRYSTCKGLITAAKAALSPVAGEG
FT                   AGRRRTEAVPPGPPSGAVPVQQQPQQAYPPPPPVQQQPYPGPQQYQQQMPQTLPPPAGD
FT                   PVRLRPPMPVGSSSFATKSGGSAKWVVPVLVVVALGVLVVLFVLMANSFGSGGGSTEPT
FT                   SSRTSTYNSNNLPSEVPTIGD"
     gtgtcggaag acctcaccgg gcgccgtctc ggccactaca agatcgacgc agtgctcggc        60
     cgcggcggta tgagcgtgat gtaccgcgcc accgatacgc ggctcggccg caaggtcgcg       120
     ctcaaggtca tgggtgagca catcaccggt gacgccgagt tccgcgagcg cttcgtcgac       180
     gaggcgcgca acacctccgc gatcgaccac gccaacatcg tgccgctgta cgacttcggc       240
     gaggtcgacg gcatgctcta catcgctatg cggctggtgg acggctccga cctggccagc       300
     aagatcaagg acgggccgat ctcggcgcag cgcaccctcg agctgctcgg gcaggtcgcc       360
     gaggcgctgg acatgctgca cgagcgcaac ctcgtccacc tcgacctcaa gccggccaac       420
     gtgctggtca cctcgcgcga gtcgtccagc gagcacgtgt acctggccga cttcggcctc       480
     acccggcgcg gcgccaccgg ccaccgcacc agcagcggcg acttcctcgg ctcgccgacc       540
     tacgccgcgc ccgagcacct tcgcggcgag cccgtcgacg ggcgcaccga cctgtacgcg       600
     ctggcctgca tgctcttcgc gtgcctgacc gggcgcccgc ccttccaggg ccaggtccag       660
     gaggtcatcc agggccacct gcacggagag ccgcccaagg tcacctcgct ggtggtgctg       720
     cccgccgaca tcgacgacgt gctgcgccgg ggcatggcca agaaggccga ccagcggtac       780
     tcgacctgca agggcctgat caccgcggcc aaggcggcgc tgtcgccggt ggccggcgag       840
     ggtgccgggc gcaggcggac cgaggccgtg ccgcccggcc cgccgtccgg tgcggtgccc       900
     gtgcaacagc agccgcagca ggcgtacccg cctccgccgc cggtgcagca gcagccctac       960
     cccgggccgc agcagtacca gcagcagatg ccgcagaccc tgccgccgcc cgccggcgac      1020
     ccggtccgcc tgcgcccgcc gatgccggtc ggctcgtcgt cgttcgccac gaagtcgggc      1080
     ggctcggcga agtgggtcgt gccggtgctg gtcgtggtcg cgctgggcgt gctcgtggtg      1140
     ctgttcgtgc tgatggccaa ctcgttcggc tccggcggcg gctccaccga gccgaccagc      1200
     tcgcggacct cgacctacaa cagcaacaac ctgccttccg aggtgccgac catcggcgac      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page