(data stored in ACNUC1104 zone)

EMBL: AM420293.PON1

AM420293.PON1        Location/Qualifiers
FT   CDS_pept        complement(350116..352626)
FT                   /transl_table=11
FT                   /gene="pon1"
FT                   /locus_tag="SACE_0314"
FT                   /product="penicillin binding protein (class A)"
FT                   /function="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99663"
FT                   /db_xref="GOA:A4F6I9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6I9"
FT                   /protein_id="CAL99663.1"
FT                   /translation="MTLSHDLTPPYAERVRVRDGVLKLFGLCVLAGVLVAGLMFPVAGS
FT                   LGVVSNRASDAVNNISAELMSQDPPLVTTVTDRAGTPIAYLFDQNRTPAAPDEIADTMK
FT                   AAIIAIEDRRFYDHRGVDWAGTVRAALTNQMSGEIAQGGSTLTQQYVKNYQVHVVAAGD
FT                   PVKQAKAIEQTPARKLREIRIALQLERRLGKEQLLARYLNVVPFGNQAYGVAAAARTYF
FT                   NTTPDQLTIAQAALLAGMVNSPSALNPENNPAEALGRRNLVIDAMLAQHRITPEAAEEA
FT                   RTSPLGLARPLRGIPNGCIGAGPSDGFFCQYVIDYLGRSGFTEDQLKRGGYTIRTTLDH
FT                   KATAAAKAAAERHVPKKTKGIANVMSVVEPGKEKHRVRALVANRDFGLDGTKGETAYAL
FT                   PSGIAKFGAGSVYKVFTAAAALERGMGIQTVIPSPPNYTSRVYKNGTAPYTVGNAEGVT
FT                   PGPRTLQKALATSPNTAFVALQERVGLSETVDMAARLGMRQTLLAADKAGDPVPEGGTV
FT                   QTQGEWMKQANIGAFTLGFAPTSPLELSNVAATIISGGTWCPPTPIEQILDRHGNPVSI
FT                   TEDSCEQAVDEALANALAVGMSMDDKPGGTAAAAASGAGWTRPMLGKTGTTEAHQSASF
FT                   LGATPQFAGAVLTFSDGTSPQGICDSTPPTLCGANGGNIYGGKVPARTWYDAMNGVHEG
FT                   LPVVPLPPTTKRYETGGSEAQVPNVVGHTAQRATEILQKAGYRVQEKSVNSQRRQGTVT
FT                   SQTPRGFALPGELVTIAISTGYVPPPSVVTPPPLPTPGRGEPGRSGEPGFPEQPGQPGQ
FT                   PGEQWLPGLPGLPGGRQGEPGLPG"
     gtgacgctga gtcacgacct gaccccgcct tacgctgagc gggtgcgagt ccgggatggc        60
     gtgctgaagc ttttcggcct gtgtgtgctg gccggcgtgc ttgtggccgg cctgatgttt       120
     ccggtggcgg gatcactcgg agtggtctcg aaccgcgcga gcgacgctgt caacaacatc       180
     tccgcggagc tcatgagcca ggatccgccc ctggtgacca cggtcacaga ccgggcggga       240
     acccccatcg cctacctctt cgaccagaac cgcacccccg cggcgcccga cgagatcgcc       300
     gacacgatga aggcggcgat catcgcgatc gaggaccgcc ggttctacga ccaccgcggc       360
     gtggactggg cgggcaccgt gcgggcggcg ctgacaaacc agatgtccgg cgagatcgcc       420
     cagggcggtt cgacgctgac ccagcagtac gtgaagaact accaggtcca cgtggtcgcc       480
     gcgggcgacc cggtcaagca ggccaaggcc atcgagcaga cccccgcgcg caagctgcgc       540
     gagatccgca tcgccctgca gctcgagcgc cggctcggca aggagcagtt gcttgcccgc       600
     tacctcaacg tggtgccctt cgggaaccag gcctacggcg tggccgcggc ggcccgcacg       660
     tacttcaaca ccacgccgga ccagctgacg atcgcacagg cggcgctgct cgcgggcatg       720
     gtcaacagcc cgagcgcgct gaacccggag aacaaccccg ccgaggcgct gggccgccgc       780
     aacctggtga tcgacgcgat gctggcgcag caccgcatca ccccggaggc cgcagaggag       840
     gcgcgcacct cgccactcgg gctggcccgg ccgctgaggg gcatccccaa cggctgcatc       900
     ggcgccgggc cgtccgacgg gttcttctgc cagtacgtga tcgactacct cggccgctcc       960
     ggtttcaccg aggaccagct caagcgcggc ggctacacca tccgcaccac gctcgaccac      1020
     aaggcgaccg cggcggcgaa ggcggccgcc gagcgccacg tgccgaagaa gaccaagggc      1080
     atcgccaacg tcatgagcgt ggtggagccg ggcaaggaga aacaccgggt gcgggcactg      1140
     gtcgccaacc gcgacttcgg cctcgacggc accaagggcg agaccgcgta cgcgctgccc      1200
     agcggcatcg ccaagttcgg cgccgggtcg gtgtacaagg tcttcaccgc cgcggcggcg      1260
     ctggaacgcg gcatgggcat ccagaccgtc atcccctcgc cgccgaacta cacctcgcgg      1320
     gtctacaaga acggcaccgc gccctacacc gtcggcaacg ccgaaggcgt gacgccgggc      1380
     ccgcgcaccc tgcagaaggc gctggcgacc tcgccgaaca ccgcgttcgt cgcgttgcag      1440
     gagcgggtcg ggctgtccga gaccgtcgac atggcggccc ggctcggcat gcgccagacc      1500
     ctgctggccg ccgacaaggc gggcgacccg gtgcccgagg gcggcacggt gcagacccag      1560
     ggcgagtgga tgaagcaggc caacatcggc gcgttcaccc tcggcttcgc cccgaccagc      1620
     ccgctggagc tgagcaacgt ggcggccacc atcatcagcg gcggcacctg gtgcccgccg      1680
     acgccgatcg agcagatcct ggaccgccac ggcaacccgg tctccatcac cgaggactcc      1740
     tgcgagcagg ccgtcgacga ggcgctggcc aacgcgctgg cggtcggcat gagcatggac      1800
     gacaagcccg gcggtaccgc cgcggcggct gccagcggcg cggggtggac gcggccgatg      1860
     ctcggcaaga ccgggaccac cgaggcccac cagtcggcca gcttcctggg tgcgacaccg      1920
     cagttcgcgg gggcggtgct gaccttcagc gacggcacct cgccgcaggg catctgcgac      1980
     agcacgccgc ccaccctgtg cggggccaac ggcggcaaca tctacggcgg caaggtgccc      2040
     gcgcgcacct ggtacgacgc gatgaacggc gtgcacgagg ggctgcccgt cgtcccgctg      2100
     ccgccgacga ccaagcgcta cgagaccggc ggcagcgagg cgcaggtgcc caacgtcgtc      2160
     gggcacaccg cgcagcgggc gaccgagatc ctgcagaagg cgggttaccg ggtgcaggag      2220
     aagtcggtca acagccagcg caggcagggc accgtgacca gccagacgcc gcgcggattc      2280
     gccctgccgg gcgagctggt gacgatcgcg atcagcaccg gatacgtgcc tccgccctcg      2340
     gtggtgacac cgccgccgct gccgactccc ggccggggag agcccgggcg gtcgggggag      2400
     cctggcttcc ccgagcagcc ggggcaaccg gggcagccag gcgagcagtg gctaccgggc      2460
     ctgcccggtc tgcccggagg acgacaaggc gagcccggac taccgggata g               2511
//

If you have problems or comments...

PBIL Back to PBIL home page