(data stored in ACNUC1104 zone)

EMBL: AM420293.RADA

AM420293.RADA        Location/Qualifiers
FT   CDS_pept        complement(489734..491116)
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SACE_0436"
FT                   /product="DNA repair protein"
FT                   /function="predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99784"
FT                   /db_xref="GOA:A4F6W0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6W0"
FT                   /protein_id="CAL99784.1"
FT                   /translation="MPAKNARTARPGFRCADCGHEVAKWVGRCPSCQAWGTIDEAAAAR
FT                   PALAKVAAGAPATPARPIAEVDLDSARAVSTGIGELDRVLGGGIVPGAVVLMAGEPGVG
FT                   KSTLLLEVAHRWAATGGGGPSLYVTGEESAGQVRLRAERTDSVHPQLYLGAESDLGSVL
FT                   GHVDSVKPGLLIVDSVQTVQSPEAEGSPGGVTQVRAVTSALVALAKERGLPVLLVGHVT
FT                   KDGAVAGPRVLEHLVDVVLHFEGDRHSSLRMLRGVKNRFGPSDEVGCFEQRDDGIAEVA
FT                   DPSGLFVNRQETQVEGTAVTVMVEGKRPLLAEVQALVTPTQMTMPRRAVSGLDSARVSM
FT                   MLAVLDKHGGVKTGDQEVFAATVGGMKVSEPAADLAVALAVASSRRGVPLPSNVIAVGE
FT                   VGLAGEIRRVNAVGRRLAEAARLGFDHALVPPDSGPLPRGVRTTVVPDIRAALRVLKRA
FT                   RT"
     gtgcccgcga agaacgcccg taccgcccgt cccggcttcc gctgcgccga ctgcggccac        60
     gaggtggcca agtgggtcgg tcgctgcccg agctgccagg cgtggggcac gatcgacgag       120
     gccgccgcgg cccggcccgc gctggccaag gtcgccgcgg gcgccccggc caccccggcc       180
     cgcccgatcg ccgaggtcga cctcgactcc gcgcgggcgg tctcgaccgg catcggcgag       240
     ctcgaccgcg tgctcggcgg cggcatcgtg ccgggcgcgg tggtgctgat ggccggcgag       300
     cccggagtcg gcaagtccac gctgctgctg gaggtcgccc accgctgggc cgcgaccggc       360
     gggggcgggc cctccctcta cgtcacgggt gaggaatccg ctggtcaggt gcgcctccgg       420
     gcggagcgga ccgactcggt ccacccgcag ctctacctcg gcgccgagag cgacctgggc       480
     tcggtgctcg ggcacgtgga ctcggtcaag cccggcctgc tgatcgtcga ctccgtgcag       540
     accgtgcagt caccggaggc cgagggcagc cccggcggcg tgacccaggt gcgcgcggtg       600
     acctccgcgc tggtcgcgct ggccaaggag cgggggctgc cggtgctgct ggtcgggcac       660
     gtgaccaagg acggcgcggt cgcgggtccg cgcgtgctgg aacacctggt cgacgtggtg       720
     ctgcacttcg agggcgaccg gcactcctcg ctgcggatgc tgcgcggggt caagaaccgc       780
     ttcggcccct ccgacgaggt gggctgcttc gagcagcgcg acgacggcat cgccgaggtc       840
     gccgacccgt cggggctgtt cgtcaaccgc caggagacgc aggtcgaggg caccgcggtg       900
     acggtcatgg tcgagggcaa gcgcccgctg ctggccgagg tgcaggcgct ggtgacgccc       960
     acccagatga cgatgccgcg gcgcgcggtc agcggactgg actccgcgcg cgtgtcgatg      1020
     atgctcgcgg tgctggacaa gcacggcggg gtcaagaccg gcgaccagga ggtgttcgcg      1080
     gcgaccgtgg gcggcatgaa ggtctccgag cctgcggccg acctcgccgt ggcgctggcg      1140
     gtcgcctcgt ctcgccgggg cgtgccgctg ccgtcgaacg tgatcgcagt gggcgaggtc      1200
     gggctggcgg gcgagatccg ccgggtcaac gccgtcggcc gcaggctcgc cgaggcggcc      1260
     cggctgggct tcgaccacgc gctggtgccg ccggactccg gtccgctgcc gcgcggcgtg      1320
     cggaccaccg tcgtgcccga catccgcgcc gcgctgcgcg tcctcaagcg ggcccggacg      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page