(data stored in ACNUC1104 zone)

EMBL: AM420293.RECF

AM420293.RECF        Location/Qualifiers
FT   CDS_pept        5261..6436
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="SACE_0005"
FT                   /product="DNA replication and repair protein"
FT                   /function="Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99359"
FT                   /db_xref="GOA:A4F5N5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F5N5"
FT                   /protein_id="CAL99359.1"
FT                   /translation="MYVRHLQVTDFRSWPHADLTFEPGPTVLVGSNGQGKTNLVEALGY
FT                   VATLGSHRVATDAPLVRYGTQRAVVRAAVVNHGRELLVELEITPGKANRARINRGAAGK
FT                   PRDVLGILRTVLFAPEDMAMVRGDPGERRRFLDDLLVARAPRYAGVRSDYDRVLRQRSA
FT                   LLKSAGAAKRGGSGGDLRTLEVWDGHLARYGAELLAGRLDLVAAIAPHVTSAYANVAAT
FT                   AEETAPSGRVADVRYRSSLGESLPEGYGVPRGEPADVEVLEKALLAELERVRAQELERG
FT                   VSLVGPHRDDLELMLGELPAKGYASHGESWSFALALRLASYHLLAEDGAEPVLILDDVF
FT                   AELDRRRRSRLAELVAGAEQVLVTAAVAEDVPEELTGVRFDVREGEVRRVE"
     gtgtacgtcc gccatctcca agtgaccgac ttccggtcct ggccgcacgc cgacctgacc        60
     ttcgagccgg ggccgaccgt gctggtcggc tccaacggcc agggcaagac caacctggtc       120
     gaggcgctcg gctacgtcgc cacgctcggc tcgcaccggg tcgcgaccga cgcaccgctc       180
     gtgcgctacg gcacccagcg cgcggtggtg cgtgccgcgg tggtcaacca cgggcgtgag       240
     ctgctggtcg agctggagat caccccgggc aaggccaacc gcgcgcggat caaccgcggt       300
     gcggccggca agccgcgcga tgtgctcggg atcctgcgca ccgtgctgtt cgcgccggag       360
     gacatggcga tggtccgggg cgaccccggc gagcgcaggc ggttcctcga cgacctgctc       420
     gtggcccgtg ccccgcgtta tgcgggcgtg cgctcggact acgaccgcgt cctgcggcaa       480
     cgcagcgcgc tgctcaaatc ggcgggcgcc gccaagcgcg gtggttcggg tggcgacctg       540
     cgcaccctgg aggtctggga cggccacctc gcgcgctacg gcgccgagct gctggccggt       600
     cggctggatc tcgtcgcggc catcgcaccc cacgtgacca gtgcgtacgc caacgtcgcg       660
     gccaccgccg aggagaccgc gccgtcgggc cgggtcgccg acgtgcgcta ccgcagcagc       720
     ctgggcgagt cgctgcccga gggctacggg gtgccgcgcg gcgagccggc cgacgtcgag       780
     gtgctggaga aggcgctgct ggccgagttg gagcgggtcc gggctcagga gctggagcga       840
     ggcgtgtcgc tggtcgggcc gcaccgcgac gacctggagc tgatgctcgg cgagctgcct       900
     gccaagggat acgccagtca cggtgaatcg tggtcgttcg ccctggcgtt gcgcctggct       960
     tcctaccacc tgctggcgga ggatggcgcg gaaccggtgt tgatcctcga cgacgtcttc      1020
     gccgagctcg accggcgccg ccgctcgcgg ctggccgagc tggtcgcggg cgccgagcag      1080
     gtgctcgtca cggcggcggt ggccgaggac gtcccggagg aactcaccgg cgtccgcttc      1140
     gacgtgcgcg aaggtgaggt gcggcgtgtc gaatga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page