(data stored in SCRATCH zone)

EMBL: AM420293.SPEE

AM420293.SPEE        Location/Qualifiers
FT   CDS_pept        complement(508722..510314)
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="SACE_0456"
FT                   /product="putative spermidine synthase"
FT                   /function="predicted spermidine synthase with an N-terminal
FT                   membrane domain"
FT                   /EC_number="2.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99804"
FT                   /db_xref="GOA:A4F6Y0"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6Y0"
FT                   /protein_id="CAL99804.1"
FT                   /translation="MSVSTEPRDETEPAAAPRPRGRLARTAVLVAVFVCAACGLVYELA
FT                   LVALGSYLIGDTIGQASIVLSLMVFAMGVGALAAKPLQRWAAAAFALVELVLALLGGLS
FT                   VLLLYAAFAWVGLYLPALIVTALVLGALIGAEIPLLMVLLQRIRKQDAGSAVADLFAAD
FT                   YVGGLVGGLAFPFLLLPLFGQIQGALLVGMLNAAAGLGLVLTVFRRELSKRVRLVLVAA
FT                   SALVGGVLLVAYVFADDFEVTARQALYADPVVHAERTDYQDVVLTERVSLSGRGDTRLF
FT                   LNGDLQFSSVDEYRYHEALVHPAMAGPRSRVLVLGGGDGLALREVLRYPDVQQVTLVEM
FT                   DPAVLDLAREDPRVAGLNRHAFDDPRVRTVSADAFAWLRDNRERYDVVLVDMPDPDSTA
FT                   TAKLYSTEFYALVRHAMADGARVNVQAGSPYFAPQAFWCIEATTRAAGISTVPYEVSVP
FT                   SFGEWGFHLGTAGAAPPLELPAGAPPLRSLDAGTLRAAAEFPPDRRRIPGMEPSTLMHP
FT                   TILSYAQGEWTNY"
     atgtccgtca gcactgaacc ccgcgacgag accgaacccg ccgcggcccc tcgcccgcgc        60
     ggacgcctcg cccgcaccgc cgtgctggtg gcggtgttcg tctgcgcggc gtgcgggctc       120
     gtctacgagc tggcgctggt cgcgctcggc agctacctga tcggcgacac gatcgggcaa       180
     gcctccatcg tgctgtcgct catggtcttc gccatgggcg tcggcgcgct ggccgccaag       240
     ccgctccagc gctgggcggc ggcggcgttc gcgctggtgg agctggtcct ggcgctgctg       300
     ggcgggctga gcgtgctgct gctctacgcg gcgttcgcct gggtgggcct gtacctgccc       360
     gcgctgatcg tgacggcgct ggtcctcggc gcgctgatcg gcgcggagat cccgctgctg       420
     atggtgctgc tccagcggat ccgcaagcag gacgcgggtt cggcggtggc cgacctgttc       480
     gccgccgact acgtcggcgg gctggtcggc ggcctggcct tcccgttcct gctgctgccg       540
     ctgttcggcc agatccaggg cgcgctgctg gtcgggatgc tcaacgccgc ggccgggctc       600
     ggcctggtgc tgacggtgtt ccgccgggag ctgtccaagc gcgtgcggtt ggtgctggtc       660
     gcggcgtcgg cgctggtcgg gggtgtgctg ctggtcgcct acgtcttcgc cgacgacttc       720
     gaggtcaccg cccggcaggc gctgtacgcc gaccccgtcg tgcacgccga gcgcacggac       780
     taccaggacg tcgtgctgac cgagcgggtc tcgctgtccg gccgcggcga cacccggctc       840
     ttcctcaacg gcgacctcca gttcagctcg gtcgacgagt accgctacca cgaggcgctg       900
     gtgcacccgg cgatggcggg gccgcgctcg cgggtgctgg tcctcggcgg cggtgacggg       960
     ctggcgctgc gcgaggtgct gcgctacccc gacgtccagc aggtcacgct ggtcgagatg      1020
     gacccggcgg tgctggacct ggcgcgcgag gacccgcggg tcgccgggct caaccggcac      1080
     gcgttcgacg atccgcgcgt tcgcaccgtg tccgccgacg ccttcgcgtg gctgcgcgac      1140
     aaccgcgagc gctacgacgt cgtgctggtc gacatgcccg acccggactc gacggccacc      1200
     gcgaagctgt actccacgga gttctacgcg ctggtcaggc acgccatggc cgacggggca      1260
     cgggtcaacg tgcaggccgg gtcgccgtac ttcgcgccgc aggcgttctg gtgcatcgag      1320
     gcgaccacgc gcgcggcggg gatctcgacg gttccctacg aggtgtcggt gccgagcttc      1380
     ggcgagtggg gcttccacct cggcacagcc ggcgccgcgc cgccgctgga gctacccgcg      1440
     ggcgccccgc cgctgcggtc gctggacgcc gggacgctgc gggcggccgc ggagttcccg      1500
     cccgaccgca ggcgcatccc aggcatggaa ccgtcgacgc tgatgcaccc gacgatcctc      1560
     agctacgccc aaggcgagtg gacgaactac tga                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page