(data stored in ACNUC1104 zone)

EMBL: AM420293.SRTB

AM420293.SRTB        Location/Qualifiers
FT   CDS_pept        54727..55548
FT                   /transl_table=11
FT                   /gene="srtB"
FT                   /locus_tag="SACE_0038"
FT                   /product="putative sortase-like protein"
FT                   /function="Sortase (surface protein transpeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99391"
FT                   /db_xref="GOA:A4F5R7"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R7"
FT                   /protein_id="CAL99391.1"
FT                   /translation="MGSTDFAVAPPPDRRPHRVRAAVRVFGEVLITLGLVLLLFVFYEV
FT                   YVTDWFTARKQDDASRRLDQQWRAPGPPPPAPGEGDAFARLHIPAFGPDYRFTVLEGTD
FT                   PATLAAGPGHYSATARPGEQGNFAVAGHRIGKGAPFNDLDRLHSCDALVVETATEWYIY
FT                   RVLPLAEEAPSWDSRAAYPKCRGVAPIGVPYDQAVGRRIVGPEQGEVIHPVPGRPRDTL
FT                   PKDQQTRLITLTTCHPEFSAAQRLIVHGVLVKRYPKDPADTGLRPPELEER"
     gtggggtcca ccgacttcgc agtggcacca ccgccggacc gccgtcccca ccgggtccgc        60
     gcggcggtcc gggtcttcgg cgaggtcctc atcaccctcg gcctggtgct cctgttgttc       120
     gtgttctacg aggtctacgt caccgactgg ttcaccgcgc gcaagcagga cgacgcgagc       180
     cgtcggctcg accagcagtg gcgggctccg gggcccccgc cgcccgcgcc gggggaggga       240
     gacgcgttcg cccggctcca cataccggcc ttcggccccg actaccggtt cacggtcctc       300
     gagggcaccg atccggcgac gctcgcggcg ggacccggcc actactcggc caccgcccgc       360
     ccaggtgagc agggcaactt cgcggtcgcc ggacaccgca tcggcaaggg cgcgccgttc       420
     aatgacctcg accggctgca ctcctgcgac gcgctggtcg tcgagaccgc gaccgagtgg       480
     tacatctacc gcgtgctgcc cctggccgag gaagccccga gctgggactc ccgggcggcg       540
     tacccgaagt gccggggcgt ggctccgatc ggagtgccct acgaccaggc ggtcggccgg       600
     cgcatcgtcg gtccggaaca gggcgaggtg atccacccgg tcccgggccg gccgcgggac       660
     accctgccga aggaccagca gaccaggctc atcaccctca ccacctgtca cccggagttc       720
     tccgcggcgc agcggctcat cgtgcacggg gtgctggtga agcggtaccc gaaggacccg       780
     gccgacaccg gcctgcgacc acccgaactc gaggagcgct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page