(data stored in ACNUC1104 zone)

EMBL: AM420293.THIC

AM420293.THIC        Location/Qualifiers
FT   CDS_pept        complement(565000..566643)
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="SACE_0511"
FT                   /product="putative thiamine biosynthesis protein"
FT                   /function="Thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99857"
FT                   /db_xref="GOA:A4F733"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A4F733"
FT                   /protein_id="CAL99857.1"
FT                   /translation="MADVRPNLSSDHHSVTTGPISGSRKVHHTTESGLKVPFRRIELSN
FT                   GEHLDVYDTSGAYTDDDVQVDVHSGLHRLRAGWTDGREHRTQLGWAKAGVVTREMEFIA
FT                   AREGVSPEFVRDEVASGRAVIPANRCHPESEPMIIGKNFLVKVNANIGNSAVTSSVEEE
FT                   VEKMVWATRWGADTVMDLSTGKRIHETREQILRNSPVPIGTVPIYQALEKVNGDPEKLT
FT                   WEIYRDTVIEQCEQGVDYMTVHAGVLLRYVPLTAQRVTGIVSRGGSIMAAWCLAHHRES
FT                   FLYTHFSELCEILRDYDVTFSLGDGLRPGSIADANDRAQFAELETLGELTHIARDMDVQ
FT                   VMIEGPGHVPMHKIVENVKLEEELCGEAPFYTLGPLTTDIAPAYDHITSGIGAAVIAQA
FT                   GTAMLCYVTPKEHLGLPNRDDVKVGVITYKIAAHAADLAKGHPRAQDWDDALSKARFEF
FT                   RWNDQFNLSLDPDTARAYHDETLPAEPAKTAHFCSMCGPKFCSMKITQDVRKYAEERGL
FT                   TSVEAIEAGMREKSDEFSESGGKVYLPVVG"
     ttggccgacg tgcgcccgaa cctgtccagc gaccaccaca gcgtgaccac cgggcccatc        60
     agcggctcgc ggaaggtcca ccacaccacc gaatccggcc tcaaggtgcc gttccgccgc       120
     atcgagctgt ccaacggcga gcacctcgac gtctacgaca cctccggcgc ctacaccgac       180
     gacgacgtgc aggtcgacgt ccacagcgga ctccaccggc tgcgggcggg ctggaccgac       240
     ggccgcgagc accgcaccca gctcggctgg gccaaggccg gtgtggtgac gcgggagatg       300
     gagttcatcg ccgcccgcga gggggtctcg ccggagttcg tccgcgacga ggtcgccagc       360
     ggtcgcgccg tgatcccggc caaccgctgc cacccggaga gcgagccgat gatcatcggc       420
     aagaacttcc tggtgaaggt caacgccaac atcggcaact ccgcggtgac ctcctcggtc       480
     gaggaggagg tcgagaagat ggtgtgggcg acccgctggg gcgccgacac cgtgatggac       540
     ctgtccaccg ggaagcggat ccacgagacc cgcgagcaga tcctgcgcaa ctcgccggtg       600
     ccgatcggca ccgtgccgat ctaccaggcg ctggagaagg tcaacggcga cccggagaag       660
     ctcacctggg agatctaccg ggacaccgtg atcgagcagt gcgagcaggg cgtggactac       720
     atgaccgtgc acgcgggcgt gctgctgcgg tacgtgccgc tcaccgcgca gcgggtcacc       780
     ggcatcgtct cccgcggcgg ctcgatcatg gcggcctggt gcctggcgca ccaccgcgag       840
     agcttcctct acacgcactt ctccgagctg tgcgagatcc tgcgcgacta cgacgtcacc       900
     ttctccctcg gcgacggcct gcgtcccggc tcgatcgccg acgccaacga ccgggcgcag       960
     ttcgccgagc tggagaccct cggcgagctg acccacatcg cccgcgacat ggacgtgcag      1020
     gtgatgatcg agggccccgg ccacgtcccg atgcacaaga tcgtggagaa cgtgaagctg      1080
     gaggaggagc tgtgcggtga ggcgccgttc tacacgctcg gcccgctgac caccgacatc      1140
     gcgcccgcct acgaccacat cacctccggc atcggcgcgg cggtgatcgc ccaggcgggc      1200
     acggcgatgc tctgctacgt cacgccgaag gagcacctgg gactgcccaa ccgcgacgac      1260
     gtgaaggtcg gcgtcatcac ctacaagatc gccgcgcacg ccgccgacct cgccaagggc      1320
     cacccccgcg cgcaggactg ggacgacgcg ctgtccaagg cccgcttcga gttccggtgg      1380
     aacgaccagt tcaacctgtc gctggacccg gacacggcgc gcgcgtacca cgacgagacc      1440
     ctgcccgccg agcccgccaa gaccgcgcac ttctgctcga tgtgcgggcc gaagttctgc      1500
     tcgatgaaga tcacccagga cgtgcgcaag tacgccgagg agcgcgggct gaccagcgtc      1560
     gaggcgatcg aggccgggat gcgggagaag tccgacgagt tctccgagtc cggcggcaag      1620
     gtctacctgc cggtggtcgg ctga                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page