(data stored in ACNUC1104 zone)

EMBL: AM420293.THID

AM420293.THID        Location/Qualifiers
FT   CDS_pept        complement(564036..564902)
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SACE_0510"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /function="Hydroxymethylpyrimidine/phosphomethylpyrimidine
FT                   kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99856"
FT                   /db_xref="GOA:A4F732"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4F732"
FT                   /protein_id="CAL99856.1"
FT                   /translation="MHETPAGHEIQPANDPAPPTALTIAGSDSGGSAGMHADLRTFFAC
FT                   GVHGMTAVTAVTVQNTVGVTGLVEIPPETVAAQVDAVASDIGVDAAKTGVLASAATIEA
FT                   VMAVCDNHGIGRGGRTPFVVDPVAASRSGEPLLRPDALDALRNEAFPRATLVTPNLDEV
FT                   RLLTGFDARTRADLLDAAKAIYDFGPQWVLIKSGHLPDDPECVDLLYDGSQATPLPGPR
FT                   YSTVHTHGAGDAFASSITAALAKGASMPDAVRLGKRFVTRSVEHAYPLGAGIGPVSTFW
FT                   RVSPRSF"
     atgcacgaga cacccgccgg gcacgagatc cagcccgcga acgaccccgc tccgccgacc        60
     gcgctgacca tcgccggttc ggactccgga ggcagcgccg gcatgcacgc cgacctgcgg       120
     acgttcttcg cgtgcggggt gcacggcatg accgcggtga cggccgtgac ggtgcagaac       180
     accgtcgggg tcaccgggct ggtcgagatc ccgccggaga cggtggccgc ccaggtcgac       240
     gcggtcgcct ccgacatcgg cgtcgacgcc gccaagaccg gcgtgctggc ctccgccgcg       300
     accatcgagg cggtcatggc cgtgtgcgac aaccacggca tcggccgcgg cggccgcacc       360
     ccgttcgtcg tcgacccggt cgccgcctcg cgcagcggcg aaccgctgct gcgccccgac       420
     gcgctcgacg cgctgcgcaa cgaggctttc ccgcgcgcga cgctggtgac gccgaacctc       480
     gacgaggtcc ggctgctgac cgggttcgac gcgcgcaccc gcgccgacct gctcgacgcg       540
     gcgaaggcga tctacgactt cggcccgcag tgggtgctca tcaagagcgg tcacctgccg       600
     gacgacccgg agtgcgtgga cctgctctac gacggcagcc aggcgacgcc gctgcccggt       660
     ccgcgatact cgaccgtgca cacccatggc gcgggcgacg ccttcgcctc gtcgatcacc       720
     gcggcgctgg ccaagggcgc gtcgatgccg gacgcggtgc ggctgggcaa gcgtttcgtg       780
     acccgaagcg tcgagcacgc ctacccgctc ggtgccggta tcggcccggt gtcgaccttc       840
     tggcgcgtca gccctcgctc gttctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page