(data stored in SCRATCH zone)

EMBL: AM420293.TPASE1

AM420293.TPASE1      Location/Qualifiers
FT   CDS_pept        469506..470273
FT                   /transl_table=11
FT                   /gene="tpase1"
FT                   /locus_tag="SACE_0417"
FT                   /product="transposase, ISlxx1"
FT                   /function="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99765"
FT                   /db_xref="GOA:A4F6U1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6U1"
FT                   /protein_id="CAL99765.1"
FT                   /translation="MAAEIAYLARALKAPSLAGAVERLAERARAEDWSHEEFLAACLQR
FT                   EVAARESHGGEGRIRTARFPSRKSLEEFDFDHQRSLKRDTITHLGTLDFIAGKENVVFL
FT                   GPPGTGKTHLSIGLGIRACQAGHRVSFATAAGWVARLAEASHAGRLQQELVKLGRIPLL
FT                   IIDEVGYIPFEAEAANLFFQLVSARYERASLIVTSNKPFGRWGEVFGDDVVAAAMIDRL
FT                   VHHAEVISLKGDSYRLKDRQDLGRVPAATNTND"
     gtggctgccg agatcgccta cctcgcccgg gcgttgaagg caccgtcgct ggccggggcg        60
     gtcgagcggc tggccgaacg ggcccgggcc gaggactggt cccacgagga gttcctggcc       120
     gcctgcctgc aacgcgaggt cgccgcccgc gagtcccacg gcggcgaggg ccgcatccgc       180
     accgcccggt tcccgagcag gaagtcgctg gaggagttcg atttcgatca ccaacgctcc       240
     ctcaaacgcg acacgatcac acatctcgga acactggact tcatcgcggg caaggaaaac       300
     gtggtcttcc tcgggcctcc cggcaccggc aagacccacc tgtcgatcgg actcgggatc       360
     cgggcctgcc aggccggaca ccgcgtctcg tttgccaccg ccgccgggtg ggtagcccgg       420
     ctcgccgagg ccagccacgc cggacgactc cagcaggaac tggtcaaact cggccggatc       480
     ccgctactga tcatcgacga ggtcggctac atcccgttcg aagccgaagc cgcgaacctg       540
     ttcttccagc tggtctccgc ccgctacgag agagccagcc tgatcgtcac cagcaacaaa       600
     cccttcggcc gctggggcga ggtcttcggc gacgacgtcg tcgccgccgc catgatcgac       660
     cgcctcgtgc accacgccga agtcatctca ctgaaaggag acagctaccg cctcaaagac       720
     cgccaagacc tcggccgcgt gcccgcggcc accaacacca acgactaa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page