(data stored in SCRATCH zone)

EMBL: AM420293.URED

AM420293.URED        Location/Qualifiers
FT   CDS_pept        701423..702190
FT                   /transl_table=11
FT                   /gene="ureD"
FT                   /locus_tag="SACE_0639"
FT                   /product="putative urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99984"
FT                   /db_xref="GOA:A4F7G0"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F7G0"
FT                   /protein_id="CAL99984.1"
FT                   /translation="MRATAALRVELAADGRNVVRELRSQPPITLIPRRGVASAAGGPAV
FT                   VHLVGSATSPMGGDRVDLRVHVGAGAALRLSGTAATVALPGQRTGHSRATVRIEVEAGG
FT                   TVEYLPEATVVSGRADHRADMRVELAEHARARCREVLVLGRYGERPGVLTTSTHVVRAG
FT                   TPLLRQRLDIGEQRLAASAGYLAGARVLAAETVVWDHDPAAPAGGQWWSLAPLSGGGAL
FT                   ATSVAADAVTAQRGLAEALGHHPDAEALTRELW"
     gtgagggcca ccgcggcgct gcgcgtcgag ctggccgccg acggccgcaa cgtcgtccgc        60
     gaactgcggt cgcagccgcc gatcacgctc atcccgcgcc gcggcgtcgc gtcggccgcg       120
     ggcggcccgg ccgtggtgca cctggtcggc tcggccacct ctccgatggg cggtgaccgc       180
     gtcgacctgc gcgtgcacgt cggtgccggt gccgcgctgc ggctgagcgg cacggcggcg       240
     acggtcgcgc tgcccggtca gcgcaccggg cacagccgcg ccaccgttcg catcgaggtc       300
     gaggcgggcg ggaccgtcga gtacctgccg gaggcgacgg tggtaagcgg tcgcgccgac       360
     caccgggcgg acatgcgggt cgagctcgcc gagcacgccc gcgcccgttg ccgcgaggtc       420
     ctggtgctgg gcaggtacgg ggagcgcccg ggggtgctga ccaccagcac gcacgtcgtg       480
     cgggcgggca cgccgctgct ccggcagcgg ctggacatcg gcgagcaacg gctggcggcc       540
     agcgcgggct acctcgcggg cgcacgggtg ctggccgccg agacggtggt gtgggaccac       600
     gacccggcgg cacccgccgg gggacagtgg tggtcgctgg ccccgctttc cggcggcgga       660
     gcgctggcga cgtcggtggc agccgacgcg gtcaccgccc agcgcggtct cgccgaggcg       720
     ctcggccacc acccggacgc cgaagccctg acccgagagc tgtggtga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page