(data stored in ACNUC1104 zone)

EMBL: AM420293.YBBC,-YZBB

AM420293.YBBC,-YZBB  Location/Qualifiers
FT   CDS_pept        complement(398078..399316)
FT                   /transl_table=11
FT                   /gene="ybbC, yzbB"
FT                   /locus_tag="SACE_0362"
FT                   /product="unknown"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99711"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N7"
FT                   /protein_id="CAL99711.1"
FT                   /translation="MDRRSFLTTSALSASMLGLTTGAACAAPPTPAPNRSGVLTGADVL
FT                   AAENWRPITGRRIGVVTNPTGVLGSMQHVVDAMHAGGDVDVVAVFGPEHGFRGTSQAGG
FT                   SEGDYADPRTGLPVYDAYGADADKLAGMFRKAGVEQVVFDIADVGVRFYTYIWSMYIAM
FT                   QAAAKVGASFLVLDRPNPIGGTQVAGPQLDPRFASGVGLLPIVLQHGMTVGELARMFAR
FT                   EHLPGTPEPEVVKVQRWHGRSPGTGLPWIPPSPNMPTPDTAMVYPGTGLFEGTTWSEGR
FT                   GTTRPFEIIGAPGVDWRWADELNAAGIPGVRFRETYFVPTFSKHTGVTCGGVQIYRDGE
FT                   IDSILVAVTMIVTARKLYPFAWREDGMIDKLFGSDRLRTMVDAGADVREIVGSWQDELA
FT                   EFRRRREAYLLYS"
     atggatcgcc gcagcttcct caccacctcc gcgctgtcgg cgtcgatgct cgggctcacc        60
     accggcgccg cctgcgccgc gccaccgacc ccggcgccga accgctccgg ggtgctgacc       120
     ggcgccgacg tgctggccgc cgagaactgg cggccgatca ccggccgccg catcggcgtg       180
     gtgaccaacc cgaccggcgt gctgggctcg atgcagcacg tcgtcgacgc catgcacgcc       240
     ggcggtgacg tcgacgtcgt cgcggtgttc ggccccgagc acggcttccg cggcacgtcg       300
     caggccggcg ggtcagaggg cgactacgcc gacccccgca ccggcctgcc ggtgtacgac       360
     gcctacggcg ccgacgccga caagctggcc gggatgttcc gcaaggccgg ggtcgagcag       420
     gtggtgttcg acatcgccga cgtcggggtg cgcttctaca cctacatctg gtcgatgtac       480
     atcgcgatgc aggccgccgc gaaggtcggg gcgtcgttcc tggtcctgga ccggccgaac       540
     ccgatcggcg gcacgcaggt cgccggtccg cagctcgacc cgcgcttcgc ctctggcgtc       600
     gggctcctgc cgatcgtgct ccagcacggc atgaccgtcg gcgagctggc caggatgttc       660
     gccagggagc acctgcccgg aacgccggag cccgaggtcg tgaaggtgca gcgctggcac       720
     ggccgcagtc ccggaaccgg gctgccgtgg attccgccga gcccgaacat gccgactccg       780
     gacacggcca tggtctaccc cggcaccggc ctgttcgagg gcacgacgtg gtccgagggt       840
     cgcggcacga cgcggccgtt cgagatcatc ggggctcccg gcgtggactg gcggtgggcc       900
     gacgagctca acgccgcggg catcccgggc gtgcggttcc gcgagaccta cttcgtgccg       960
     acgttctcca agcacaccgg ggtgacgtgc ggaggtgtgc agatctaccg cgacggcgag      1020
     atcgactcga tcctcgtcgc cgtgaccatg atcgtcaccg ccaggaagct ctacccgttc      1080
     gcctggcgcg aggacgggat gatcgacaag ttgttcggat ccgaccggtt gcgcacgatg      1140
     gtggacgcgg gtgcggacgt gcgcgagatc gtcgggtcgt ggcaggacga gctggcggag      1200
     ttccgccgcc ggcgcgaggc ttatctcctc tacagctga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page