(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00040

AM920435.PC20G00040  Location/Qualifiers
FT   CDS_pept        complement(join(14959..15522,15629..15667,15728..16016,
FT                   16081..16191,16269..16609))
FT                   /gene="Pc20g00040"
FT                   /locus_tag="PCH_Pc20g00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00040"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85333"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER2"
FT                   /protein_id="CAP85333.1"
FT                   /translation="MPPRPFFPRAAKPNGKGAPKKSDGKRKANSESEDAEATPPKKKKM
FT                   TKEEIPQKLDEKRLAADLNTDYSKRRKNLRNIRPQMPKKQKWPKVKGVIREREDAPQGW
FT                   NPEEPDLMPDDFESQIQRCLERITENIMPHVYQHKLTELRAKQAERDALKATEPGLSWP
FT                   VVQRLDDLKFTLDWIMAENDKYKMADTVKSIIAQYRSGELDWHPEFVTYWHAGVQLCLP
FT                   RPFHWEEYRSIHDKCQGHEGFWVEGILGPAPGLSKSSVVRLSLRIPQDQPPAGTKLPSF
FT                   EFPFMDDTGSTHMSIFEDDINILQDNTNHPLPRCLGVGLHYTSDDRRVPALYRELEVNM
FT                   WSVDERGFMSNWEPIPVSIRSGHATRAGADRLSGSWLRHRFYTGTCPDQSMRLYVFNYN
FT                   PGIPPQGERTLPTATPAQLTAPFRTAALRPVGEFPHLDPNFASGHSLI"
     atgcctccaa ggcctttttt ccctcgcgcc gcaaaaccta acggtaaagg tgcgcccaag        60
     aagtcggatg gaaaacgcaa ggcaaatagc gagagtgaag atgcagaggc aacccctcca       120
     aagaagaaga agatgacaaa agaagaaatc ccgcagaagc tggacgagaa acgtcttgca       180
     gccgatctca acactgacta ttcgaaacga aggaagaatc ttaggaatat taggccacaa       240
     atgcccaaga aacagaaatg gccaaaagta aaaggcgtta tcagagagcg ggaagatgca       300
     cctcaaggct ggaacccaga ggagccagat ctgatgcccg atgacttcga atctcagatc       360
     caaaggtgtc ttgagcggat cacagagaat atcatgcctc atgtctatca gcataaactg       420
     acagaattga gggcaaagca ggcggagcgc gatgcactga aggctacaga gcccggttta       480
     agttggcccg ttgtacaacg cctagatgat ctcaaattta cgttggattg gatcatggcg       540
     gaaaacgaca agtacaagat ggccgatacg gtaaaatcca ttattgcaca atatcgatca       600
     ggtgaattag attggcatcc ggaatttgtc acctattggc atgctggagt tcagctctgt       660
     ctgccaaggc ctttccactg ggaggaatac cgcagcattc atgacaaatg ccagggacat       720
     gaagggtttt gggtcgaagg tattctcggg cctgcgcctg gcttgagcaa atcttcggta       780
     gtgaggctta gccttcggat cccgcaggat cagccacctg caggaacaaa attaccgagc       840
     ttcgaattcc cgttcatgga tgacaccgga tctacgcata tgagcatatt tgaagacgac       900
     atcaacattc ttcaggataa cacgaaccac cccttgcccc gatgtctggg tgttggtctc       960
     cactatacct cagatgacag gcgggtcccc gcgttatata gagaattaga agtcaacatg      1020
     tggagtgtgg acgaacgggg cttcatgtcc aactgggagc cgataccggt ttctatccga      1080
     agtggtcatg caacgagggc cggcgctgac cgtttgagtg ggtcatggtt gcgacacagg      1140
     ttttacactg gaacttgtcc tgaccagtcc atgcgtcttt atgtgttcaa ctataaccct      1200
     gggataccac cacagggcga gaggactctt cctactgcga ccccggcaca attgaccgcg      1260
     cccttccgaa ctgcagcgct tcgtccggtt ggagagtttc ctcatcttga tccaaatttc      1320
     gcatcagggc atagtttgat ctaa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page