(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00060

AM920435.PC20G00060  Location/Qualifiers
FT   CDS_pept        complement(join(21371..22115,22174..22409))
FT                   /gene="Pc20g00060"
FT                   /locus_tag="PCH_Pc20g00060"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   ncu06607.1 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85335"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER4"
FT                   /protein_id="CAP85335.1"
FT                   /translation="MYYARPAALSAVLLQVLPTLAAPAPGGSGNPGEWSQDGFWGSPGH
FT                   GDSAGIGPGGFDNSHCGHNANGNNVGSTVTVTDCPATPTATVTVTIDGDGNGSATVTET
FT                   ISACTATVTTGDDGRSASTTTETETVISTISSCTATTTDITTLTEDGPTVTTTVTTPGP
FT                   VSTTTEFVGTSTVTEPGVTEYETVTDTITHTDTSTVTNNQVVTSTVTSTETQTLQVTTT
FT                   VTADDCSNTGTSDDLDYGSCSDPTINWLYGLDGRTEYSYTTNNQDDFPFGSSPTIDSPA
FT                   DLICNRLRSPCNAPQATIDQCYAAESAVASLSGQEAADTWNDLMT"
     atgtattacg caagacccgc cgctctttcg gccgtcctgc tgcaggtgct ccctaccctt        60
     gcagctcctg cccccggtgg ctctggtaat cccggcgagt ggagccagga tgggttctgg       120
     ggatctcccg gccatggaga cagcgcgggc ataggtccag gagggtttga taacagccac       180
     tgtggccaca atgccaacgg caacaatgtc ggatcgactg tcactgtgac tgattgcccg       240
     gctaccccga ctgccaccgt gactgttact attgacggcg atggcaacgg ttcagccact       300
     gtcaccgaaa cgatcagtgc ctgcacagca actgtaacca ccggcgacga cggccgttcc       360
     gcatcaacca ccaccgagac ggaaactgtg atctccacga ttagttcgtg caccgccacg       420
     accaccgaca tcaccacttt gacggaggac ggtcccaccg tgacgaccac tgtcacaacg       480
     cccggcccag tctcaactac caccgaattt gtcggcacct cgaccgtcac cgagcccggc       540
     gtgaccgagt acgagacagt caccgatacc atcactcata ccgacacaag cactgttacc       600
     aacaaccagg ttgtgacctc caccgtgact tcgacagaga cccagacact ccaggtcact       660
     accacagtga ctgcggacga ctgctccaac accggcacat cggacgatct tgactatgga       720
     agctgttcgg acccgacgat aaactggttg tatggtcttg atggtcgcac cgagtactcg       780
     tataccacca ataatcagga tgacttcccc ttcggctcgt cgcctactat cgattctccg       840
     gctgacctga tatgcaaccg tttgcgtagc ccgtgcaatg ctcctcaggc tacgattgac       900
     cagtgctatg cggctgagag cgctgttgcc tctctgagtg gacaggaggc tgccgatact       960
     tggaacgact tgatgacata g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page