(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00080

AM920435.PC20G00080  Location/Qualifiers
FT   CDS_pept        complement(join(24030..24430,24501..24669,24727..25296))
FT                   /gene="Pc20g00080"
FT                   /locus_tag="PCH_Pc20g00080"
FT                   /note="unknown EC_number=4.2.2.10"
FT                   /note="Title: strong similarity to pectin lyase pelA
FT                   -Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85337"
FT                   /db_xref="GOA:B6HER6"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER6"
FT                   /inference="similar to AA sequence:PIR:S17979"
FT                   /inference="protein motif:PFAM:PF00544"
FT                   /inference="protein motif:COGS:COG3866"
FT                   /protein_id="CAP85337.1"
FT                   /translation="MKFSLGLLFAAVAVASSPAKRADAVSVTGSPPGFAYGVTGGGDAT
FT                   PVYPTDVKHLIELLGSDDPQVIIIDKTFDFIGTEGTTKGNICKAYGSFEDGCQSTIDIG
FT                   KGCDGKPSEPYEWDTAGTTGITVQSDKTIIGVGNKGVLLGKGLRIVRASNIIVQNIMIT
FT                   NLNPQLVWGGDAITLSGTSKVWIDHVTTQYTGRVHYVFGHEANAHVTISNSFMNGATNF
FT                   STSCDGQNYWGLELVGADDQITFANNYVYRTSGRSPALSGKTLFHAVNSVWEDNSGHAI
FT                   EGTDDGQGLFEGCVFNNVTQIVGDFVGQLFSSPSATANKECAGYLKRDCVTNIQTNNGD
FT                   QFTNADTKFFSNFAGLNIATASAASAAQASVPTNAGNTL"
     atgaagttca gcctcggttt actattcgcc gctgtggcag ttgcaagcag cccagccaag        60
     cgagccgatg cggtttcggt tactggctcg cccccaggat ttgcatacgg agttacggga       120
     ggtggtgatg cgacgccagt ttatccaacc gatgtcaaac atctaatcga acttttgggt       180
     tctgatgatc ctcaggtcat catcatcgac aagacattcg atttcatcgg aacggaaggg       240
     acaaccaagg gaaacatctg caaggcatac ggttcctttg aggatggttg ccagtccacg       300
     atagatatcg gaaaaggatg cgacggtaaa ccgtccgagc cgtacgagtg ggatactgct       360
     ggaaccacag gaattaccgt tcaatcagac aagacgatta tcggagtcgg aaacaagggc       420
     gtactcctcg gcaaagggct gagaatagtc cgtgcctcca acatcattgt acagaacatc       480
     atgatcacca acctcaaccc acaacttgtc tggggtggtg acgctatcac actctctggc       540
     acttcgaagg tctggattga ccatgttacg actcaataca ctggccgtgt acactatgtc       600
     tttggccacg aagccaacgc tcatgtcact atctccaaca gcttcatgaa tggcgcaact       660
     aacttctcta cttcgtgcga cggacaaaac tactggggat tggagcttgt cggagccgat       720
     gaccagatca catttgcaaa caactacgtg taccgcacat ccggccgcag ccctgcactg       780
     agcggtaaga cgctcttcca tgccgtcaac agcgtgtggg aggacaacag cggccacgcc       840
     attgagggca ccgacgacgg ccaaggtctc ttcgaaggtt gtgtcttcaa caatgtcacc       900
     caaatcgttg gagatttcgt cggtcaactc tttagctcgc cgagtgctac tgccaacaaa       960
     gaatgcgccg gctaccttaa gagggattgc gtgactaata tccaaacaaa caatggggat      1020
     cagtttacga acgccgatac taagttcttc tctaatttcg ccggcctcaa cattgcaact      1080
     gcaagtgcag cttcggcggc ccaggcaagc gtcccaacca atgctggaaa cacactttag      1140
//

If you have problems or comments...

PBIL Back to PBIL home page