(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00180

AM920435.PC20G00180  Location/Qualifiers
FT   CDS_pept        join(54698..54729,54775..54859,54919..55044,55106..55156,
FT                   55220..57704,57760..57929,57992..58204)
FT                   /gene="Pc20g00180"
FT                   /locus_tag="PCH_Pc20g00180"
FT                   /note="Title: strong similarity to ankyrin repeat protein
FT                   Nuc-2 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00180"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85347"
FT                   /db_xref="GOA:B6HF29"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF29"
FT                   /inference="similar to AA sequence:PIR:S72479"
FT                   /inference="protein motif:PFAM:PF03105"
FT                   /inference="protein motif:COGS:COG0666"
FT                   /inference="protein motif:COGS:COG0584"
FT                   /protein_id="CAP85347.1"
FT                   /translation="MYVCPSVSVTGKFGKQIQRRQLDLPEYAASFVNYKALKKLIKQLS
FT                   ATPTIPAQRTAEEIARANADPQGALRANKEVFFFRLEREIEKVNTFYLQKESEFSLRLR
FT                   TLVDKKRVTQSRATSNSKAPSNFAAMFEGFQQFDGDLNKLQQFVEINETAMSKILKKWD
FT                   KTSKSRMKELYLHRAVEVQPCFNREVLRDLADRATTARLELEAWAEGENIQYDASRPLD
FT                   RTATLGSEEDEMDSQILQSASTGNLQTLREWLARLQQLPDARERATRTFLTAINGFSDE
FT                   VLGLLLESKLVDIHAEDDINERNCLHEAAISGRLFVFHAGLQAGVDFARADVYGRIPLH
FT                   YACMHGRVDMVRHLLAAGPHTVDIMDHDNFTPLIHSIVKGQLACAEQVLCSNARVDPEP
FT                   ESPPMKGMDHRPLKGPDHIPLNLACQHGSLPIARMLLERNAKLLPDAEGLYPQHMVARA
FT                   SQSPELLLLLKEHGADLDQKDKLYQWTPLFHAASEGCVPCLRTLLECGVDAQVPDEKGL
FT                   SSMYYAAWEGHLECMLLLWAQPSGKKPTLGPLDILNGVRMQEPGPMGDMSVVTSVSELE
FT                   MADGIPDLELPPPIIPLRRYGHNFLDKKVFVQLLFDQGNVGSIAFDQAGRHPAARMTIS
FT                   SKLSDLIPRTVMLPIQEETRTISFHVDNLDTFAVDFEIFPTFGSKVIAKSVALPDIFRA
FT                   ESSSTGSGCLPLFDPRLRTIGQLRFNFQVIKPYHGDPLEITHFATYWKATSALDSDHNG
FT                   LVTGSSLSGDYVQLFVQLTQDRVAVLYPQFMINHHGVDIPVSHLTYAQFQAIGADCGAN
FT                   HTEILKFLETEATNDMPQTHRLLAASFLSLRDVLQQLPIDLNVNISLLYPSPTEEKKLH
FT                   MTSLADVNSFADVILTDVFDHARVARDKNPEFMRSVVFTSYNPNICSALNWKQPNYPVL
FT                   LCNDLGQIRDLAGNVDSMPHVNSSGRASMSIKESARIAQSNNFMGLICRSSLLNVVPAL
FT                   VETIKELGLVLVADTSDEVSQPDRLEELPTDTMGVAEWAYRMPDGVNGVMRANGILRFN
FT                   DMIDM"
     atgtacgtat gcccttccgt ttctgttacc gggaaattcg gcaaacagat ccagcgcagg        60
     cagctagatc ttcctgaata tgccgccagc tttgttaact acaaggcact gaagaagctg       120
     atcaagcaac tcagtgccac cccgactatc ccggcacaga gaacagccga ggaaattgcg       180
     agagctaatg cggaccccca gggcgccttg cgcgcaaaca aggaggtgtt cttcttccgt       240
     ttggaacgag agattgagaa agtcaacact ttctacctcc agaaagaatc agagttttct       300
     ctgcgcctaa ggacgttggt cgacaagaaa cgggtaactc aatcccgagc cacctcaaat       360
     tccaaagcac catcgaattt tgctgctatg ttcgaaggct tccaacaatt cgatggtgac       420
     ctgaacaaat tgcagcaatt cgttgagatc aatgagactg ccatgtctaa aatcctcaag       480
     aaatgggata aaacatccaa gtctcgtatg aaagagctgt atctgcatcg ggcagtcgaa       540
     gtgcaaccat gcttcaaccg tgaagttctt cgagaccttg cggacagagc taccaccgcg       600
     cgactggaat tagaggcctg ggccgagggt gagaacattc aatatgacgc ctcacgtcca       660
     ttagaccgta ccgcaacctt ggggtcggaa gaggatgaaa tggacagcca gatcttgcag       720
     tcagcctcca ccggtaacct gcaaacccta cgtgaatggc tggccaggtt gcagcagttg       780
     ccggacgccc gtgaacgtgc cacccgtaca ttcctgaccg ccatcaacgg gttctcggat       840
     gaagtgctcg gtctgctatt ggagagcaaa ctggttgaca tacacgccga ggacgacatc       900
     aacgaacgaa actgcctcca cgaagccgcc atttcgggcc gattatttgt cttccacgcg       960
     ggtctacagg caggtgttga tttcgcccgc gccgatgtct atggtcgaat ccccctccac      1020
     tacgcgtgca tgcacggccg cgtggatatg gtgcgacatc tgctcgcagc cggccctcat      1080
     accgtcgata tcatggacca tgacaacttt acacctctaa ttcacagcat cgtaaagggc      1140
     cagctggcgt gcgccgagca ggttctgtgt agtaatgccc gcgtcgatcc agagcccgag      1200
     tcgcctccta tgaagggaat ggaccaccgg cccttgaagg ggcccgatca tattcctttg      1260
     aatctcgcct gtcaacacgg ctctctcccc atcgcgagga tgcttcttga gcgaaatgcg      1320
     aagttactgc ctgatgcaga gggtctatat ccccagcata tggttgcacg cgcctcacaa      1380
     tcaccagagc tactattact gctgaaggag cacggtgctg atctcgacca gaaggacaag      1440
     ctataccagt ggactccact gttccatgcc gctagcgagg gctgcgttcc ctgcctacgc      1500
     actcttctcg agtgcggggt tgatgcccag gtcccagatg aaaagggcct ctcgtctatg      1560
     tactatgctg cctgggaagg gcatctggag tgcatgctcc ttctctgggc acagccctcc      1620
     ggcaaaaagc ctacactggg accgcttgac attctcaatg gcgtgcggat gcaagaaccc      1680
     ggcccgatgg gcgacatgtc tgtagttacg agcgtctctg aattggaaat ggctgatggc      1740
     atcccggacc ttgaattgcc tcctcccatt atccctctcc gccgctatgg tcacaacttc      1800
     ctcgacaaga aagtatttgt gcagcttctg ttcgatcaag gaaatgtcgg gtctattgcc      1860
     tttgaccagg caggccgcca tcctgctgct cgcatgacca tctcttccaa gctgtcagat      1920
     ctcattcctc gtactgtcat gctacccatt caggaagaga cgcgcacaat atcgttccac      1980
     gtggataatt tggacacctt tgctgtggac tttgagatct tccctacctt tggttcaaag      2040
     gtgattgcaa agagtgtggc tctgccagac atcttccgtg ccgagtcgtc cagcactggc      2100
     tcaggctgcc tgcctctatt cgacccccga cttcgtacaa tcggccagct gcgcttcaac      2160
     ttccaagtga tcaagccata ccatggtgat cctctggaga ttacacactt tgctacatac      2220
     tggaaggcca ctagtgccct tgactcagac cacaatggac tggtcactgg ttccagcttg      2280
     tcgggagatt atgtccagct ctttgtacaa ctgacccagg accgcgtcgc agtcctttac      2340
     ccgcaattta tgatcaacca ccacggagtc gacatcccag tgtctcattt gacatatgcc      2400
     cagttccagg ccattggcgc agactgcggt gccaaccata ccgagatcct caagttcttg      2460
     gaaacagaag cgacgaatga catgccgcag actcatcgac tcctagcggc gtcgttcttg      2520
     tcgttacgcg atgtcttgca acaactccct attgacttga atgtcaatat ctccctcctc      2580
     tacccgtcgc ctacggagga gaagaaactc cacatgactt ctttggcgga tgttaatagc      2640
     tttgccgatg ttatcctgac cgacgtcttt gatcatgccc gtgtggcccg cgacaagaat      2700
     ccagagttca tgcgttccgt ggtgttcacc tcctacaacc cgaacatttg tagtgctctc      2760
     aactggaagc aaccaaacta tcctgttctt ctttgcaacg atcttggtca aattcgggac      2820
     ctggctggga acgtcgactc gatgccccat gtcaatagca gtggccgggc ctcaatgtcg      2880
     attaaggagt ctgctcgcat tgcccagagc aacaacttta tgggcctgat ctgcagatct      2940
     agccttttga atgtcgttcc tgcgctcgtc gaaaccatca aggagctcgg ccttgtgctt      3000
     gtagccgaca cctctgatga ggtcagtcag ccggatcgac tcgaggagct acccactgat      3060
     accatgggcg ttgccgaatg ggcataccgc atgcctgacg gtgtcaacgg cgttatgaga      3120
     gccaacggca ttctgagatt taacgatatg atcgatatgt ga                         3162
//

If you have problems or comments...

PBIL Back to PBIL home page