(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00190

AM920435.PC20G00190  Location/Qualifiers
FT   CDS_pept        complement(join(58635..58786,58852..59425))
FT                   /gene="Pc20g00190"
FT                   /locus_tag="PCH_Pc20g00190"
FT                   /note="unknown EC_number=2.3.1.88"
FT                   /note="Title: weak similarity to
FT                   methionine-N-acetyltransferase Nat2 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85348"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF30"
FT                   /inference="similar to AA sequence:TREMBL:SCNAT2N.1"
FT                   /protein_id="CAP85348.1"
FT                   /translation="MSLRPTLLKQWISRPSEILKSTPSLTSYLHPSARPSLAHRSIIFP
FT                   SAGQATRRSLTTARLPTRTRPGPSSFHPKQRRFNSGSAGGGGKGSGAGAGAGASEKASL
FT                   SQRLKKLSREYGWAALGVYLGLSALDFPFCFAAVRLLGVERIGYYEHVVVGFVKDKLKS
FT                   VWPQTKSSEAEDGQGQLAQAEERNQEEASIWTQLVFAYAIHKSFVFIRVPLTAAVTPKV
FT                   VKTLRGWGWDIGKRKPKST"
     atgtccctcc gcccaaccct cctcaaacaa tggatctcgc ggccgagcga gatcctcaaa        60
     tcaaccccaa gcttaacctc atacctccac ccctcggccc gtccatccct cgcacaccgc       120
     agcataatat tcccgtccgc agggcaagca acacgacgaa gccttaccac agcgcgcttg       180
     ccgacgcgca cccgtccggg accgagctcg ttccacccca agcagcgccg gttcaattcc       240
     gggtcggctg gcggtggtgg taagggatct ggggctggag ctggagctgg agcttcggag       300
     aaggcgtcgc tgtcgcagcg gctgaagaag ctctcgcggg agtatggatg ggctgcgctg       360
     ggagtgtatc ttggactgtc ggcgctggat ttcccattct gttttgcggc tgtgcggttg       420
     cttggtgttg agcgcattgg atactatgag catgtcgttg ttggattcgt caaggataag       480
     ctcaagtctg tgtggccgca gactaagagt tctgaggcgg aggatgggca ggggcaactt       540
     gctcaggctg aggaacggaa tcaggaagaa gctagtatct ggacacaatt ggttttcgct       600
     tatgccatcc acaagagctt tgtgtttatt cgagtaccgt tgacggcggc tgtgacgcca       660
     aaggttgtga agacgctgcg tggatggggt tgggatattg ggaagagaaa gcccaagagt       720
     acatga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page