(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00240

AM920435.PC20G00240  Location/Qualifiers
FT   CDS_pept        66030..67286
FT                   /gene="Pc20g00240"
FT                   /locus_tag="PCH_Pc20g00240"
FT                   /note="unknown EC_number=2.5.-.-"
FT                   /note="Title: strong similarity to para-hydroxybenzoate
FT                   polyprenyltransferase Coq2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85353"
FT                   /db_xref="GOA:B6HF35"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF35"
FT                   /inference="similar to AA sequence:PIR:S20056"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /inference="protein motif:COGS:COG0382"
FT                   /inference="protein motif:COGS:COG0109"
FT                   /protein_id="CAP85353.1"
FT                   /translation="MLSTSSRLLRARLSPYRQKVNLTGLYNGRLPTFAHNAYSPTQLKD
FT                   PRFLASGSSIALRTTQVQVRHSSQLQSPATQPTETDSAEKNPATHYILPKTGLIASLPS
FT                   SWIPYAELVRLDKPTGTYYLFFPTLFSTLLAAPMAGAAPLHVLGTSALFFSGALIMRGA
FT                   GCAINDLWDRNLDPHVERTKFRPIARGALSPKNAILFTGSQLVAGLGVLLSFPTQCLWY
FT                   GIPSLPIVVAYPLAKRVTNYPQAVLGLAFSWGAIMGFPALGVDLLANHDALMAAGALYS
FT                   SCIAWTVLYDMIYAHMDIKDDVKAGIKSIALRHEHNTKAVLSGLAVTQVSLLAAAGVAA
FT                   GCGPVFFVGSCGSAVLSLGLMIWKVQLKNVRNCWWWFRNGCLLTGGGISLGLFAEYATQ
FT                   YLGLYNTTEPERVVAESTQ"
     atgctttcca ctagctcccg tctcctccgc gctcgactat ccccatacag gcaaaaggtc        60
     aacctcactg gtctatacaa tgggcgcctt cccacattcg ctcacaatgc ctattccccg       120
     acgcaattga aagacccccg atttctcgcc agtggctcat ccattgcctt gcgaacaaca       180
     caagtccaag tccgacacag ctcacagttg caatcgcccg caacacaacc aaccgagacg       240
     gatagtgcgg agaagaaccc agccacgcac tatatcctgc caaaaaccgg cttgattgcg       300
     tctctgccga gttcatggat accgtatgcg gaattggtgc ggctggacaa gcccacgggc       360
     acatactacc tattcttccc aactctcttc tccaccctcc tcgctgcgcc aatggctggt       420
     gcagcaccgc tccatgtcct gggaacatca gcactgttct tttccggtgc gctgatcatg       480
     cgcggtgcag gctgcgccat aaatgacttg tgggatcgaa acctggaccc tcacgtcgaa       540
     cgcaccaagt tccgacccat cgcccgaggt gcactgtcgc cgaaaaatgc aatacttttt       600
     acaggctcac agttggtggc tgggttgggc gtgcttcttt cgttccctac ccagtgcctt       660
     tggtatggga ttcctagctt gcctatcgtg gtggcatacc cccttgctaa gcgcgtgacc       720
     aattacccgc aagctgtgct tgggcttgcc ttttcatggg gagcgattat gggattccca       780
     gcgttggggg tggacctgct tgccaatcat gatgccttga tggctgcagg tgccctttat       840
     tccagttgta ttgcttggac agttctgtac gatatgatct atgcacatat ggacattaaa       900
     gacgatgtta aggccgggat caagtcaatc gccctccgcc atgagcacaa caccaaggct       960
     gtcctgagtg gcttggcggt gactcaggtc tccctcctcg ccgctgcagg agttgctgcc      1020
     ggttgcggac ctgtattctt cgttggcagc tgcggcagtg ccgttttgtc gcttggtctc      1080
     atgatttgga aggttcagtt gaagaatgtt cggaactgct ggtggtggtt caggaacgga      1140
     tgtctgctga ccggtggggg gatctccttg ggcttgttcg ccgagtacgc gacgcagtac      1200
     cttggtctgt acaatacgac ggagccggag cgcgtagtgg ccgagtcaac gcaataa         1257
//

If you have problems or comments...

PBIL Back to PBIL home page