(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00250

AM920435.PC20G00250  Location/Qualifiers
FT   CDS_pept        complement(join(67334..67734,67794..68109))
FT                   /gene="Pc20g00250"
FT                   /locus_tag="PCH_Pc20g00250"
FT                   /note="Title: strong similarity to hypothetical thymidylate
FT                   synthase-like DNA metabolism protein SPAC15E1.04
FT                   -Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85354"
FT                   /db_xref="GOA:B6HF36"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF36"
FT                   /inference="similar to AA sequence:PIR:T37719"
FT                   /inference="protein motif:PFAM:PF02441"
FT                   /inference="protein motif:COGS:COG0452"
FT                   /protein_id="CAP85354.1"
FT                   /translation="MDSQVSPTPFIAEQYTNDNKTHVLLAAATINLRNIAEALCRNKNI
FT                   SVRILVSEPAEKFLAGQSLEQPVLGTLLQIDGVDAIYRDQDEWSPSWTRGGPVLHIELR
FT                   KWAHILLVAPMSANTMAKTANGIADNLLLSVIRAWDTTGVVDMGFKTQKPMIFAALDMD
FT                   PCTYRHPVTEKQLTVLRDQWGWSESNPEGWLTVLPPIEKNLAYGDVGAGSAGSMMDWRD
FT                   IVTVVQHYVAGLAQQS"
     atggattctc aagtatcgcc tacgccgttt attgcggagc agtatacaaa tgacaacaag        60
     acccatgtgc tacttgcagc cgctaccatt aacctgcgca acattgctga ggcactatgt       120
     cgtaataaaa acatatcagt ccgcatccta gtcagcgagc ctgcggagaa gttcctcgct       180
     ggacagagct tggagcagcc ggttctcggc actctgcttc aaatagatgg tgtggacgct       240
     atctaccggg accaagatga atggtcccca tcatggactc gcggaggacc agttctgcat       300
     attgaactgc gcaagtgggc gcatattcta ctggttgccc caatgtctgc aaataccatg       360
     gcgaaaacgg ctaatgggat cgccgacaac ctgcttctat cggttatcag ggcctgggat       420
     acgactggag tagtggatat gggcttcaag acccagaaac ctatgatctt tgcagcgttg       480
     gatatggacc cctgtacgta caggcatcca gtgaccgaga aacagcttac agttctacgc       540
     gatcagtggg gatggagtga atcaaaccca gaaggctggt tgactgtgct tcctcccata       600
     gagaagaact tggcttatgg agatgtcggt gctgggagtg ctggcagtat gatggactgg       660
     agagatatcg tcactgtcgt ccaacactac gtggcgggat tggcacagca gtcgtga          717
//

If you have problems or comments...

PBIL Back to PBIL home page