(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00270

AM920435.PC20G00270  Location/Qualifiers
FT   CDS_pept        complement(join(69223..69546,69601..70375,70435..70552,
FT                   70613..70739))
FT                   /gene="Pc20g00270"
FT                   /locus_tag="PCH_Pc20g00270"
FT                   /note="unknown EC_number=2.7.7.14"
FT                   /note="Title: similarity to CTP:phosphoethanolamine
FT                   cytidylyltransferase ET - Rattus norvegicus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85356"
FT                   /db_xref="GOA:B6HF38"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR041723"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF38"
FT                   /inference="protein motif:PFAM:PF01467"
FT                   /inference="protein motif:COGS:COG0615"
FT                   /inference="protein motif:COGS:COG0669"
FT                   /inference="protein motif:COGS:COG2870"
FT                   /protein_id="CAP85356.1"
FT                   /translation="MDSTPIEEQVPLPGKWPVDPQEDVPISEDRLWVDGCFDFSHHGHA
FT                   GAMLQARQLGKALYVGIHSDEAILENKGPTVMSLEERVAAVDACRWATQSVPHAPYVTY
FT                   LPWVSHYGCKYVVHGDDITSDSDGNDCYRFVKAAGRFRVVKRTPGISTTDLVGRMLLCT
FT                   RNHFVKSVKGTLAGLEGYGSPEERQASAKDLLRRIKDYATDESGLQPGPQVWTWTGSGT
FT                   AKMDHVVEEAGLFETLVDGKGPKPGQRVVYVDGGFDLFSSGHIAFLRKVTELEESEGRQ
FT                   RGWYEPDQVAKRLKDHGEDYGPSYIVAGIHDDDVINHWKGLNYPIMNIFERGLCVLQCR
FT                   YINAVIFSAPFTPSEPYLKAIPWGTPDAVYHGPTTFIPLTYDPYTAPKKMGIFREAEQH
FT                   AFQHVNAGEIVGRILKSREAYEARQRAKLDKAIAEDLVKSQEAAQAAQ"
     atggactcaa cacccatcga ggagcaggtt cctttgcctg gaaaatggcc tgttgatcct        60
     caggaggatg taccaatctc ggaggaccga ctttgggtcg acggatgctt tgacttcagc       120
     caccacggtc atgccggtgc tatgctccaa gcccgccagc taggaaaggc cctttacgtg       180
     ggaatacact ccgatgaagc tattctcgag aacaagggtc caacagtgat gtcactggaa       240
     gaacgtgtcg cagccgttga cgcgtgtcga tgggcaactc agagtgttcc ccatgccccc       300
     tatgtgacct acctaccctg ggtatcccac tacgggtgca aatacgttgt ccacggagat       360
     gatattactt ctgacagtga tggaaacgac tgttaccgct tcgtaaaagc cgctggacga       420
     ttccgtgtcg ttaaacgtac tcccgggatc tcgacaaccg atctcgttgg ccgcatgctg       480
     ttgtgcacta ggaaccactt tgtcaaatcc gtgaagggta cactcgctgg attggaagga       540
     tatggaagcc ccgaagagcg ccaggcttct gctaaagacc ttttgcggag aatcaaggat       600
     tacgcgacgg acgagagtgg tctccaacct gggcctcagg tgtggacatg gacaggttca       660
     ggcaccgcga agatggacca cgtcgtcgag gaggctggcc tgtttgagac gttggtcgac       720
     ggaaagggac ccaaacccgg gcagagggtt gtttatgttg acggagggtt cgacctcttt       780
     tcctccggtc acattgcgtt cctgcgcaaa gttacggagc tcgaggagtc cgagggccgg       840
     caacgtggct ggtatgagcc ggatcaagtt gcaaagaggt tgaaggacca cggagaggac       900
     tatggaccgt cctatattgt cgcaggtatc catgatgatg atgttatcaa ccattggaaa       960
     ggcttgaact acccaatcat gaacattttt gaacgtggtc tctgtgttct tcaatgccgc      1020
     tacatcaatg ctgtcatatt ctctgcacca tttaccccca gcgaaccata tctgaaggca      1080
     atcccgtggg gcactcccga tgctgtctac catggaccca cgaccttcat ccccctgaca      1140
     tatgatccat acactgctcc caagaagatg ggaatcttcc gggaagccga gcagcatgcc      1200
     ttccaacatg tgaacgctgg cgaaattgtt ggtcggatcc tgaagagccg tgaagcttat      1260
     gaagccaggc aacgcgcaaa gctggacaag gccattgctg aggatctggt gaagtcacaa      1320
     gaggcagctc aagcagctca gtag                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page