(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00300

AM920435.PC20G00300  Location/Qualifiers
FT   CDS_pept        join(73759..74041,74151..74500)
FT                   /gene="Pc20g00300"
FT                   /locus_tag="PCH_Pc20g00300"
FT                   /note="Title: similarity to derepression of telomeric
FT                   silencing protein Dot5 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00300"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85359"
FT                   /db_xref="GOA:B6HF41"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF41"
FT                   /inference="similar to AA sequence:PIR:S48445"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /inference="protein motif:COGS:COG0450"
FT                   /inference="protein motif:COGS:COG1225"
FT                   /protein_id="CAP85359.1"
FT                   /translation="MVELRKRKAPAPLLVAEKKTKQAPKPKQDADATDNDTEKRPAQKV
FT                   PEVDDIIDIETFSGEFETNEGEKTTLKKLLEESKSGVVFFTYPKASTPGCTKQACLFRD
FT                   NYTHLTSTGLSIYGLSGDSPKANTTFKTRQNLPYPLMCDPKATLIAAIGFKKSPKGTTR
FT                   GIFAVDKKGKVLLRAAGGPDATVDAVQKIVANAPSVEDSKEEGDETA"
     atggtcgaac tcaggaaacg caaggcacca gccccgctac tcgtcgcaga gaagaagacc        60
     aaacaagctc ccaagcccaa acaagacgca gatgctaccg ataatgacac tgagaaaaga       120
     cccgcgcaga aggtccctga ggtggatgat ataatcgaca tagaaacctt cagtggcgag       180
     tttgagacca atgagggtga aaaaacaact ttgaagaagc tcctcgagga gagcaagtcg       240
     ggcgtggttt tctttactta ccccaaagcc tcaacacctg gctgtaccaa gcaagcttgc       300
     ttgttccgtg acaactacac ccacctgact tctactggcc tttctatcta cggtctttct       360
     ggtgactcgc caaaggccaa cactacattc aagacaagac agaacctacc ttaccctctc       420
     atgtgtgacc ccaaggccac ccttattgca gctattgggt tcaagaaatc tcctaagggt       480
     acaacgcgag gtatatttgc cgtggataag aagggcaagg tcttacttcg cgcggctggt       540
     ggcccagacg cgactgtgga cgctgtccag aagattgttg ccaatgcgcc tagtgtggaa       600
     gatagcaagg aggaaggtga tgaaacagcg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page