(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00340

AM920435.PC20G00340  Location/Qualifiers
FT   CDS_pept        complement(join(80608..80742,80801..81105,81164..81179))
FT                   /gene="Pc20g00340"
FT                   /locus_tag="PCH_Pc20g00340"
FT                   /note="Title: similarity to hypothetical protein
FT                   SPAC15E1.02c - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85363"
FT                   /db_xref="GOA:B6HFD1"
FT                   /db_xref="InterPro:IPR013879"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD1"
FT                   /inference="similar to AA sequence:PIR:T37717"
FT                   /protein_id="CAP85363.1"
FT                   /translation="MTTLHYLPPVKPSAIALGTIFTHTASLGILAPVFGDTYHRAQAAN
FT                   SKEEFIKSKEAAGAAAAWGSSLAGSAVQTYGVAALINATGTLSYKGAAYLGTLIFFASS
FT                   APGIVSQVFSEKRPLDTIAVGAVSRVFETVGLSLFLTWWGTRTHPFD"
     atgactaccc tgcactacct ccccccagtg aagccctccg ccattgcgct gggtacaatc        60
     ttcacccaca ctgcctccct tggcatccta gcccccgtct tcggtgatac ttaccaccgc       120
     gctcaagccg ccaactcgaa agaggaattc atcaagtcta aggaggctgc tggcgcagcc       180
     gcagcctggg gaagctccct cgctggaagt gccgtgcaga cctacggtgt ggctgcactg       240
     atcaatgcca ccggcacact gagttacaag ggtgctgcgt acctgggtac acttattttc       300
     ttcgcaagct cagctccagg cattgtgagc caggtcttct ccgagaagcg acccctcgac       360
     actatcgctg tcggtgcggt ctcgagagtg ttcgagactg ttggactcag cttgttcctc       420
     acctggtggg gaacacgtac tcacccattc gactaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page