(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00400

AM920435.PC20G00400  Location/Qualifiers
FT   CDS_pept        join(91003..91115,91151..91661,91733..91921)
FT                   /gene="Pc20g00400"
FT                   /locus_tag="PCH_Pc20g00400"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1412_scaffold_7.tfa_160wg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85369"
FT                   /db_xref="GOA:B6HFD6"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD6"
FT                   /protein_id="CAP85369.1"
FT                   /translation="MPERVSPLPRGIGTTTPLLSTLLQSTRPLKGLLNSRALLELPPDH
FT                   SVQTRESVLNSKEPKWSRPVRIHCYLKSYYGNGGSQNCLHWRDWESSTHPYHLVPLELS
FT                   VLTRLQDNPLHISLFPPYSDSTIEFSFLLNSCLDIFDIRCKQTSIDQDLGLLHAIDERL
FT                   AAYGWLTTTGVKLLIIVDLFGQEEASAGKQAGAAINGLRDSDVKPAFRALQSAYIQLLQ
FT                   NPFYSPDDHVPIPGNTASSLSACQPISNKKFIADVKRIGDSWAPGSSL"
     atgcctgaac gcgtctcccc attgccgcgg gggattggga caaccactcc gctactgtct        60
     acacttttgc aaagtacccg tcccttgaaa gggttactca actccagggc attactagaa       120
     cttccacctg atcacagtgt ccagacaagg gaatcagtcc taaactccaa agagcccaag       180
     tggtcgcgcc cagtccgcat acattgctac ctcaagagct attacggaaa tggcgggtcc       240
     cagaattgcc tgcattggcg tgattgggaa agcagtacgc atccctacca tcttgtccct       300
     ctggaactgt ccgtgctaac tcggttgcag gataaccctc ttcacatttc cctgtttccc       360
     ccgtattcag attccactat cgaattttcc ttcttactga actcctgcct cgacattttc       420
     gacatccggt gcaaacaaac atccattgat caggatctag gcctcttaca tgcaattgac       480
     gaacgacttg cagcctatgg atggttgacg accacgggag taaaactgtt gataattgtg       540
     gatttattcg gccaggaaga ggccagcgct ggaaagcaag caggcgctgc gatcaatggc       600
     ttgagagatt ctgatgtgaa gcctgcattc cgcgcattac agagtgcata tattcagctt       660
     ttgcagaatc cattctattc ccccgatgac cacgtaccca ttcccgggaa tacagcgtct       720
     tctttgtccg cttgccagcc aatctctaac aaaaagttca ttgcggatgt taaacgtatc       780
     ggggattcgt gggctccagg ttcttctctg tag                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page