(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00420

AM920435.PC20G00420  Location/Qualifiers
FT   CDS_pept        94327..98433
FT                   /gene="Pc20g00420"
FT                   /locus_tag="PCH_Pc20g00420"
FT                   /note="Title: similarity to nuclear pore protein Nup133
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85371"
FT                   /db_xref="GOA:B6HFD8"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="InterPro:IPR037624"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD8"
FT                   /inference="similar to AA sequence:PIR:S38160"
FT                   /inference="protein motif:PFAM:PF04044"
FT                   /protein_id="CAP85371.1"
FT                   /translation="MFVPKAGGRNTRRRQRTSSDDSVKPPKAKRQRSVLRRPDESPSDT
FT                   NLGRELAKLATPTTPNGDIAPTDQMSELHLSTRVVKQGDVSGNNNEGTVVLVGYFISLR
FT                   VPSDSQVQTANLLGSKSSTDFYTVDQLPSLPDQIRGLQSGISNSIAFSHLGLRFVDTHP
FT                   LNAEPLKCFFGPGHDHALALTRSHAIVWPYSAPASSPSPSETFTVSIPESCRDPKGAVP
FT                   LGVLLSTATGDHPGLLVIIPSTGKVVYWETVSSAASLGLSRQKQNGIQGSTPGMLSGEY
FT                   ATDILNGEPSGIIVTFSSGRVAHITLRDPQGKPSVLVNFLRSTAGTGGGGIFGGLKNVF
FT                   AGGSWRKEVTAVRAGGSHQRGQRDVIIATSTGLVEIWDTHWNHGNTLKKRYDLKEEILA
FT                   ALPEYHAQPTNDTELKVADFAFSTLQSSDDAVQLSDGSWRLFLVVRSPQWLETRALFVA
FT                   QVHLSGNESRVMSTHAVDLRHIPASQLETSKPKIFVPKPEETAFILIGQSLVILSLTSV
FT                   EESPSSQLLLDSNKLPLPFQDTIHLRSGTDHEILGSMSEDQSNDSPCAACVLMLRNFGV
FT                   IRVTVLPRPGIEQDVDEPQVTAKHKLEQAVFFGTMAKNPLNLSSEGDLNFPPSEMEQAS
FT                   LEICRELLQSETRFIPTTAISLEQNLRLRAKALDDLASLLSRQGNPVSRPARWELLWAA
FT                   EKIAAQRAMWKVQEACKIKNGEEGPFLSHVIASMHDKFKTPINPQQGETDPVRQWFLRD
FT                   SYRMEHIIPWIKNAIKLGRSNTSNPARALSEKILAASELFLAVTETAFRYRDEHVALYG
FT                   LRGDFLEDGVLSDGYEDLPEFWTSRGVGYSEAGHLLDLELDSCRSWKTPASAADAPDTH
FT                   VLNQVAKNSYRHLRVIGQMHLERTRWLSAQGDPKLMDESVSIEQAHVEDRKWQLFKLAG
FT                   IDHLADAVELAESFRDMGALVELIIELQDQKATQHPQPPSDVSTNQTDIDADQLIAKYF
FT                   DKFGDIWADAYFSRQIAMGYPGTLFTMRKYQSAVTRFLRSNPAYSRLSWINDVIGEDDY
FT                   DTAATSLEDLAIGSEKDLWSHRVEISLAKLGKLATKERMDSPVVASTLQEDVKRLDDYV
FT                   EVDGIQDILYSHIQPILQGAIDRKAELELVLDQCGEHIFEDRPSLHEILSDALFTLIER
FT                   QVVGADGLIDILTLMGPAQLADDTEGELVRSEFHLALQVLDYGRYGQRDPSYLTALRRL
FT                   IWRRCLIKDDWVARGKAAEGPNGNASNLVADTTLYRSLTACLEGDFVPNINTWTIELTS
FT                   VPCLEPRNAGLHSLYTPLSPAEALMTDSDSDILVSRFRPEQKSRVASDLQTENDILRQC
FT                   IEVGKLDFWFQNLRETAEVHISPPE"
     atgttcgtcc ctaaagccgg tggtcgcaat actcgtcgac gccagcgaac gagctcagat        60
     gactctgtca aaccaccaaa ggccaagaga caacgctctg tcctgcgacg cccagatgaa       120
     tccccttccg ataccaacct gggacgtgag ctcgcaaaat tagcaacacc cactacgcca       180
     aacggcgaca ttgcccctac ggatcaaatg agcgagttgc atctatcgac ccgtgttgtg       240
     aaacaaggcg atgtgtctgg aaacaataac gaggggacag tcgttctggt gggctacttc       300
     atatctttgc gcgttccttc agactctcaa gtccaaactg ctaacttgct gggttcaaag       360
     tcaagcaccg atttttacac agtggatcag ctgccgtcct tgccagatca aattcgcggc       420
     ttacaatcag gtatctcaaa ttctatagct ttttctcacc ttggtttgcg atttgttgac       480
     actcaccctc tgaacgcaga acccctcaag tgctttttcg gacctggtca tgaccacgca       540
     ttagctttga cccgctcgca tgccatcgtg tggccatatt ccgcgcccgc ctcatccccg       600
     tctccgtcgg agacgttcac ggtatcgatt ccggagtctt gcagagatcc caagggtgcc       660
     gtcccgctcg gagttctatt atccacggcc acaggtgacc accccggtct cttggtgatt       720
     atcccttcta caggaaaagt cgtttactgg gagactgtgt ccagtgccgc gtcactgggt       780
     ttatcccgac aaaagcagaa tggcatccaa ggatccaccc ctggcatgct ttctggtgag       840
     tatgccacgg atatactcaa tggggagcct tcgggcatca tcgttacgtt ctcgtccgga       900
     cgagtagcac acatcaccct gcgggacccc caaggaaaac cttccgtgct cgttaatttc       960
     ctcagaagca ccgcagggac tggaggcggt ggaattttcg ggggtctcaa gaatgtcttt      1020
     gcaggcgggt catggagaaa ggaggtcact gctgttcggg ccggtggttc tcaccaacgc      1080
     ggccagcgag atgtcattat tgcaacttcg accggattgg ttgagatatg ggacacgcat      1140
     tggaaccacg gaaacacgct caaaaaacga tatgacctca aggaagaaat cctggcggcc      1200
     ctccccgaat atcacgcgca accgacaaac gatacggagc tcaaagtcgc ggactttgcg      1260
     ttctctaccc tgcagtcttc cgacgatgct gtgcaacttt ccgatgggtc ctggcgcctc      1320
     tttctggttg tcagatcgcc acagtggtta gaaacaaggg cgctattcgt ggctcaagtt      1380
     catctgtctg gcaatgaatc tcgtgttatg tcaacgcatg ccgtggatct tcgccatatt      1440
     cctgcctctc agctcgaaac ttcgaaaccc aagatatttg tgccgaagcc agaagaaacg      1500
     gctttcatcc ttattggcca gtctcttgtt atcctgtcgt tgacaagtgt cgaagagagt      1560
     ccatcctcac aactgcttct cgattccaac aagttgcctc tgcctttcca agatacgatt      1620
     cacttgcgct ctggtacaga ccacgaaatc ctggggtcca tgtcagagga ccaatcgaac      1680
     gattcgcctt gcgcagcgtg tgtgcttatg cttcgtaatt tcggtgtaat tcgtgtgacg      1740
     gtactccctc gtcctggcat cgaacaagat gtcgacgagc ctcaagtcac agcaaagcac      1800
     aagcttgaac aggcggtttt ctttgggacc atggcaaaga atccgttgaa cttatccagc      1860
     gaaggagact tgaacttccc tccatcagaa atggagcaag catctttgga aatctgcagg      1920
     gagctactcc agtcagagac tcgcttcatt cccaccactg ctatttcact agaacaaaat      1980
     ctccgcttga gagcaaaggc actggacgat cttgcctcgt tactatcacg tcaaggcaat      2040
     cctgtgagtc gaccggcaag gtgggagttg ctgtgggctg cggagaaaat tgcagcacaa      2100
     agagctatgt ggaaggttca agaggcctgt aagatcaaaa atggagaaga ggggcctttc      2160
     ctcagtcatg tcattgcgtc catgcatgat aaattcaaga ctccaatcaa cccccaacag      2220
     ggagagaccg atccggtgcg tcaatggttc ctgagagact cttaccgcat ggagcatatc      2280
     atcccatgga tcaagaacgc aatcaagctc ggtcgaagca acacttccaa ccctgcccgt      2340
     gcattgtcag agaagattct ggcggccagt gagctgtttc tggcggtaac tgaaactgct      2400
     ttccggtatc gtgatgagca cgttgcgctt tatggtctcc gtggagactt cctggaggat      2460
     ggtgtgcttt ccgatgggta cgaggatctt cccgagttct ggacatcgag aggtgttggt      2520
     tactctgaag cagggcattt actcgacttg gaactggata gttgccggtc atggaaaaca      2580
     cccgcatcgg ctgcagatgc ccccgacacg catgttttga atcaagttgc gaaaaacagc      2640
     tatcgacacc ttcgcgtaat cggtcagatg catctcgagc ggactcgatg gctttctgcg      2700
     caaggagatc ccaaactaat ggatgagagt gtctcgatag agcaggccca tgtcgaagac      2760
     cgcaaatggc aactcttcaa gctggctggt atcgaccatc ttgccgatgc tgtcgagtta      2820
     gcagaaagct tccgagacat gggagcgttg gtcgagttga tcatcgagct tcaagaccaa      2880
     aaggcaactc aacatccgca acccccgagt gatgtttcca caaatcaaac tgatatcgat      2940
     gccgaccaat tgatcgccaa gtatttcgac aagtttggtg acatatgggc ggatgcatac      3000
     ttctcccggc aaatcgcgat gggttaccca ggcacgctgt ttacgatgcg aaaataccaa      3060
     tctgccgtca ctcgattcct tcgaagcaac cccgcatatt ctcgcctaag ctggattaac      3120
     gatgtcatcg gtgaagacga ctatgacact gccgcaacct cattagaaga cctagcgatt      3180
     ggcagtgaga aagacttgtg gagccaccgt gtagagatct cgctagccaa gctaggcaaa      3240
     ctagcgacga aggagcgaat ggattctccc gttgtggctt ctaccttgca agaggatgtg      3300
     aagcgtcttg atgactatgt tgaggtcgat gggatccaag acatcctcta ttcccacatc      3360
     cagcctatcc tgcagggcgc cattgaccga aaggcagaac tcgagctagt tctcgatcag      3420
     tgtggagaac atatcttcga agatcggcca tcgcttcatg aaatcttgag cgacgctctc      3480
     tttaccttga tcgaaaggca ggttgtcggt gccgatggcc tgattgatat cttgacgttg      3540
     atgggccctg ctcagctcgc agatgatacc gagggcgagc ttgtgcgaag cgagttccat      3600
     cttgcgttgc aggttcttga ctatggacgc tatggccagc gagacccgtc ctatctcacg      3660
     gctttacgga gattgatctg gcgacggtgc ttgatcaaag atgattgggt ggctcgagga      3720
     aaagctgctg agggacccaa cggcaatgca tccaacttgg tcgctgacac cacgctctac      3780
     cgatcactaa ctgcatgctt ggaaggtgac tttgttccca acataaacac ttggactatt      3840
     gagctaacca gcgtgccatg tctagaacct cgaaatgctg gtctgcactc tctttacaca      3900
     cctctctcac ccgcggaggc tctgatgacc gattccgatt ccgacattct cgtgtcacgg      3960
     ttccgccctg agcaaaaatc tcgtgtggcg tccgatcttc agaccgaaaa tgatattttg      4020
     cgccagtgca ttgaggttgg gaagcttgat ttctggttcc aaaacctccg ggaaaccgct      4080
     gaggtccaca tatcaccccc cgaatag                                          4107
//

If you have problems or comments...

PBIL Back to PBIL home page