(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00440

AM920435.PC20G00440  Location/Qualifiers
FT   CDS_pept        complement(join(100966..101109,101176..101677,
FT                   101741..101766,101819..101903,102012..102025))
FT                   /gene="Pc20g00440"
FT                   /locus_tag="PCH_Pc20g00440"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the small subunit Rp10b - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85373"
FT                   /db_xref="GOA:B6HFE0"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="InterPro:IPR027500"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HFE0"
FT                   /inference="similar to AA sequence:SWISSPROT:RS3B_YEAST"
FT                   /inference="protein motif:PFAM:PF01015"
FT                   /inference="protein motif:COGS:COG1890"
FT                   /protein_id="CAP85373.1"
FT                   /translation="MAVGKNKRLSKGKKGIKKRTVDPFTRKDEYSVKAPSTFQTRDVGK
FT                   TLVNRTSGLKNANDSLKGRIFEVSLADLQNDEDHAFRKVKLRVDEIQGKNCLTNFHGLD
FT                   FTTDKLRSLVRKWQSLIEANITVKTTDDYLLRLFAIAFTKRRPNQIKKTTYARSSQIRA
FT                   IRKKMTEIIQREASTCTLSQLTHKLIPEVIGREIEKSTQGIYPLQNVHIRKVKLLKSPK
FT                   FDLGALLALHGESATDDKGQKVEREFKETVLESV"
     atggctgttg gaaagaacaa gcgcctatct aagggtaaga agggtatcaa gaagcgcaca        60
     gtcgacccct tcactcgcaa ggacgagtac tctgtgaagg ctccctccac cttccagacc       120
     cgcgatgtcg gcaagactct ggtcaaccgc accagcggtc tgaagaacgc caacgactcc       180
     ctcaagggcc gtatcttcga ggtctccctc gccgacctcc agaacgatga ggaccacgcc       240
     ttccgcaagg tcaagctccg cgtcgacgag atccagggca agaactgcct gaccaacttc       300
     cacggtctcg acttcaccac cgacaagctc cgttcccttg tccgcaagtg gcagtccctg       360
     attgaggcca acatcaccgt gaagaccact gatgactacc tcctccgcct gttcgccatt       420
     gccttcacca agagacgccc caaccagatc aagaagacca cctacgcccg ctcgtctcag       480
     atccgtgcca tccgcaagaa gatgaccgag atcatccagc gcgaggcttc cacctgcacc       540
     ctgtctcagc tcacccacaa gctcatcccc gaggttattg gacgtgagat cgagaagtcc       600
     acccagggca tctaccccct gcagaatgtc cacattcgca aggttaagct cctcaagtcg       660
     cccaagttcg acctcggtgc tctcctcgct ctgcacggag agtccgcgac tgatgacaag       720
     ggacagaagg ttgagcggga gttcaaggag accgtcctcg agagtgttta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page