(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00610

AM920435.PC20G00610  Location/Qualifiers
FT   CDS_pept        complement(join(139261..139297,139347..139551,
FT                   139606..139760,139811..139842,139895..140326))
FT                   /gene="Pc20g00610"
FT                   /locus_tag="PCH_Pc20g00610"
FT                   /note="Title: strong similarity to kidney injury associated
FT                   molecule HW034 protein 2 like protein An17g02285
FT                   -Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00610"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85390"
FT                   /db_xref="InterPro:IPR012462"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG08"
FT                   /protein_id="CAP85390.1"
FT                   /translation="MPSWLKKMLGKGGNISKQTQITSDGKLTRRKTVENETDHLIPVLA
FT                   RLCEQDNSVQRAFLCSPKVRHICKMRREGGFCGYRNIQMMVSWVKKSGSFGHEHFPKEG
FT                   PTILELQDMIESAWDMGFNSSGRVETGGIKDTRKFIGTPEAQALFMSLGIPCEARSLPE
FT                   RSDVRACDALYIDVADYFRSACPPEDETKVIQTDLPPIYFQHQGHSMTIVGFEIRDNGS
FT                   ANLLVFDPMFKTSPAMERLIGAFVKPSDPTRLLKAYRRGTPYLQKYKIFELLKLCITSP
FT                   KQDAT"
     atgccatcat ggctaaagaa gatgctggga aagggcggca acatatcaaa gcaaactcag        60
     atcacatcag atggcaaatt gacacgacgc aagacagtag aaaatgagac cgaccacttg       120
     attcctgttc ttgctcggct gtgtgagcag gacaattctg tccaacgggc attcctctgt       180
     agccccaaag tccgccatat ctgcaagatg cgccgggaag gcgggttttg cggctatcgc       240
     aatatccaaa tgatggtttc ttgggtgaaa aagtcgggta gctttggcca tgaacatttc       300
     ccaaaggagg ggccgactat ccttgagttg caggatatga ttgagtcggc ctgggatatg       360
     gggttcaata gctctggaag agttgagaca ggtggtatca aagatacacg caagtttatt       420
     ggaacgcctg aagcacaagc acttttcatg agcctaggaa ttccatgtga agccaggagc       480
     ctgccagaga gaagcgatgt acgggcctgc gatgctcttt acattgatgt cgccgactat       540
     ttccggtcag cgtgcccacc agaagacgag acgaaggtca tccagactga tctccctccg       600
     atatacttcc agcaccaagg tcattccatg acaattgtcg gctttgaaat acgagacaac       660
     ggcagcgcaa atctgctggt attcgatccc atgttcaaga cttctcctgc aatggagcgt       720
     ctcatcgggg catttgtcaa gccctcagac cccactcgtc ttctcaaagc atatcgcaga       780
     ggaacgcctt atctgcaaaa gtacaagata ttcgagcttc tcaagctatg cataaccagc       840
     ccgaaacaag atgccacata g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page