(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00620

AM920435.PC20G00620  Location/Qualifiers
FT   CDS_pept        complement(140374..140913)
FT                   /gene="Pc20g00620"
FT                   /locus_tag="PCH_Pc20g00620"
FT                   /note="Title: similarity to hypothetical protein An17g02283
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85391"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG09"
FT                   /protein_id="CAP85391.1"
FT                   /translation="MTDNNTASCPFCPFTDSDAGFVSQHIEFCHPETGVTGFLEETPQE
FT                   FTAQNPAPLPVDEDGADKYVDCPHGCGETIEIAELSSHLDLHVAEDMALDDIGATSARS
FT                   TPDAHGHEYDETFDDEDPLDMLESYKGGKRGMQRDSTRANTAKPPRPHSPPRTINADGI
FT                   KRLGVFVSYLHFKDKY"
     atgaccgaca acaacaccgc ctcatgcccc ttttgtccct ttacagactc tgatgctggt        60
     tttgtgtccc aacacattga attctgccat ccagaaactg gagtaactgg tttcctggag       120
     gaaaccccgc aagagttcac agcccaaaac ccggctccac tgccagtgga cgaggatggc       180
     gcagacaaat atgtggactg cccacacgga tgtggtgaga caatagaaat tgccgagctc       240
     tcgagtcatc tggatctgca tgttgcggaa gacatggcgc tggatgatat cggggccaca       300
     tcggcacggt caaccccaga tgcacatggc catgaatatg atgagacctt tgatgatgaa       360
     gatccccttg acatgctcga atcttacaag ggaggcaagc gtgggatgca acgagactcc       420
     acacgagcaa acactgccaa accaccacgg cctcacagtc ccccaaggac aattaatgcc       480
     gatggcataa agagattagg ggtatttgtc tcatacctgc attttaaaga taagtactaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page