(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00660

AM920435.PC20G00660  Location/Qualifiers
FT   CDS_pept        complement(join(153528..153671,153729..153859,
FT                   153929..154100))
FT                   /gene="Pc20g00660"
FT                   /locus_tag="PCH_Pc20g00660"
FT                   /note="Title: strong similarity to protein G10 - Xenopus
FT                   laevis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85395"
FT                   /db_xref="GOA:B6HG13"
FT                   /db_xref="InterPro:IPR001748"
FT                   /db_xref="InterPro:IPR018230"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG13"
FT                   /inference="similar to AA sequence:PIR:S05955"
FT                   /inference="protein motif:PFAM:PF01125"
FT                   /inference="protein motif:COGS:COG5132"
FT                   /protein_id="CAP85395.1"
FT                   /translation="MPPIRTSRNRKPPPAGFDDIEDTLLEFSNKMKDAENASHEGKKKY
FT                   EVLWPIFQISHQRSRYIYDLYYEKEAISKELYDFLLKNKYADANLIAKWKKQGYEKLCC
FT                   LRCVQTKETNFNSTCICRVPKAQLKEDQTIQCVSCGCNGCGSSD"
     atgcctccaa ttcgcacttc ccgcaatcgc aaaccgcctc ccgccggctt cgacgatatt        60
     gaagatacct tgctggaatt cagcaacaaa atgaaggatg cggaaaacgc atcgcatgaa       120
     ggaaagaaga aatatgaagt tctctggccg atattccaga tcagccatca acgctcacga       180
     tacatctacg acctttacta cgagaaagaa gcgatctcaa aggagttata tgatttcctg       240
     ctcaagaaca agtatgccga tgccaacttg attgccaagt ggaagaagca gggctacgag       300
     aagctgtgtt gtctgcgctg cgtccaaacg aaagagacaa atttcaattc cacgtgtatc       360
     tgccgagtgc ccaaggcgca gctcaaggag gaccagacga ttcagtgtgt cagctgtggc       420
     tgcaacggct gtggaagcag cgactaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page