(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00670

AM920435.PC20G00670  Location/Qualifiers
FT   CDS_pept        join(154391..154490,154624..154799)
FT                   /gene="Pc20g00670"
FT                   /locus_tag="PCH_Pc20g00670"
FT                   /note="Title: similarity to hypothetical protein ncu06225.1
FT                   - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85396"
FT                   /db_xref="GOA:B6HG14"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039238"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG14"
FT                   /inference="protein motif:PFAM:PF02953"
FT                   /protein_id="CAP85396.1"
FT                   /translation="MEQQLDLTKLSESDKKELNQVLTNEAQKSNIQQTVHHLNEVCWEK
FT                   CITSKITSGTLDKSEEACAQNCVDRWMDTSLSILSKLDSMRGGPGH"
     atggaacaac agctcgatct caccaagctc tccgagagcg ataagaagga gctcaaccag        60
     gtcctgacca acgaggctca gaaatccaac attcagcaga ctgtccacca cctgaacgaa       120
     gtgtgctggg agaagtgcat caccagcaag atcacctccg gtactcttga taagtccgag       180
     gaggcatgtg cacagaactg cgttgaccgg tggatggata ccagtctgtc catcctgtcg       240
     aagctggaca gcatgcgcgg tggccccggt cactaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page