(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00830

AM920435.PC20G00830  Location/Qualifiers
FT   CDS_pept        183895..184422
FT                   /gene="Pc20g00830"
FT                   /locus_tag="PCH_Pc20g00830"
FT                   /note="Title: similarity to hypothetical protein An12g06250
FT                   - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00830"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85412"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD3"
FT                   /protein_id="CAP85412.1"
FT                   /translation="MNLNGLSWPTKHLHASTRNGSTWGYVIYRTTYTPHSNAAFLRIIE
FT                   LLNSYMKQGLYSECVSSENNTSMDTDLTTYHEIWAQHRPIVMNHPRFDGASIDSIRAHF
FT                   RCWVGQQEDQGYCTQYRMCMVIDEESLQTLLDAPPPQESSDEKIIDPMRHVKVVTLLPD
FT                   SDDDEFDSFLGG"
     atgaatctca atgggctttc ctggcctacg aagcacctcc acgcgagcac taggaacgga        60
     tcgacatggg gctatgtcat ttaccgcacc acatatactc cccattccaa cgccgcattc       120
     ctccggatta tcgagctcct caactcctac atgaaacagg ggctatactc tgaatgcgtc       180
     tcctcagaaa acaatacctc aatggataca gacctcacta catatcacga aatctgggcc       240
     cagcaccgtc caatcgtcat gaaccatccg agatttgacg gagcttcgat agactcaatt       300
     cgcgcacatt tccgatgctg ggttggtcaa caggaggatc aaggctattg tactcagtat       360
     cgcatgtgta tggtgatcga cgaagagtct ttacagacgt tgctggatgc tccgccgccc       420
     caagagagct cggatgaaaa gatcattgat ccaatgcgac atgtgaaggt ggtaacacta       480
     cttccggata gcgatgatga tgagtttgac agttttttgg gtggatag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page