(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00850

AM920435.PC20G00850  Location/Qualifiers
FT   CDS_pept        join(188262..188366,188422..188500,188562..188632,
FT                   188698..188796)
FT                   /gene="Pc20g00850"
FT                   /locus_tag="PCH_Pc20g00850"
FT                   /note="Title: strong similarity to ring-box protein 1 RBX1
FT                   - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00850"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85414"
FT                   /db_xref="GOA:B6HGD5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024766"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGD5"
FT                   /inference="similar to AA sequence:TREMBL:BC017370.1"
FT                   /inference="protein motif:COGS:COG5194"
FT                   /inference="protein motif:COGS:COG5540"
FT                   /inference="protein motif:COGS:COG5183"
FT                   /inference="protein motif:COGS:COG5243"
FT                   /inference="protein motif:COGS:COG5219"
FT                   /inference="protein motif:COGS:COG0553"
FT                   /inference="protein motif:COGS:COG5574"
FT                   /inference="protein motif:COGS:COG5432"
FT                   /protein_id="CAP85414.1"
FT                   /translation="MTDVEMKEAATGSSKGKAVAKGSDNADKKKFEVKKWNAVALWAWD
FT                   IVVDNCAICRNHIMDLCIECQANQGSSTTEECTVAWGICNHAFHFHCISRWLKTRQVCP
FT                   LDNRDWEFQKYGR"
     atgacagacg tggagatgaa ggaagccgct actggctcct ccaagggcaa ggccgtcgcc        60
     aagggctccg ataatgcgga caagaagaag ttcgaggtca agaagtggaa cgctgttgcc       120
     ctgtgggctt gggatattgt cgtcgacaac tgtgccattt gccgaaacca catcatggac       180
     ttgtgcatcg aatgccaggc caaccaaggg tcatcaacaa cggaagagtg cactgttgcc       240
     tggggtatct gcaaccacgc attccacttc cactgtatat cgagatggct gaagacccgc       300
     caagtctgcc cgctagacaa ccgagactgg gagttccaga agtacggccg gtaa             354
//

If you have problems or comments...

PBIL Back to PBIL home page