(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00900

AM920435.PC20G00900  Location/Qualifiers
FT   CDS_pept        complement(197868..198476)
FT                   /gene="Pc20g00900"
FT                   /locus_tag="PCH_Pc20g00900"
FT                   /note="Title: strong similarity to pyruvate water dikinase
FT                   like protein An04g08210 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00900"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85419"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE0"
FT                   /protein_id="CAP85419.1"
FT                   /translation="MSIETSESETASLATPIKTPAAEEEEEKEKDTCRPSIYSPANLLS
FT                   SLLSPFSFSSTSPESTTTTSPNNDKDKEKEKTKSPSKISIETPTSASTQSTPEPYYTPE
FT                   ETPLFKTLYKTRLTKTRTKQLLRAGERGYDDPPPPPGLGDCCGSSCDPCVRDLWKQEIG
FT                   IWRERWGDRGVEDGVGVSTDEKKSEKKEEKLAKRKDLEW"
     atgagcattg agacatcaga gagcgaaact gcttcattgg caacgccaat aaagacacca        60
     gcagcagaag aagaagaaga gaaagagaaa gacacatgca gaccttcaat atactcccca       120
     gcaaacctac tctcaagtct cctctccccg ttctctttct caagcacgtc tccagagtca       180
     accaccacaa catccccaaa caatgacaaa gacaaagaga aagagaagac caaaagtcca       240
     agtaaaatat caatcgaaac tccaacctca gcctcaacac aatcaacccc ggagccatat       300
     tacacacccg aagaaacacc cctcttcaag accctctaca aaactcgtct cacaaaaact       360
     cgcacaaagc aacttctccg cgcaggagag cgaggatatg atgacccacc accgccaccg       420
     ggactgggtg attgttgtgg gagttcgtgt gatccttgtg ttagggattt gtggaagcaa       480
     gagattggga tttggaggga gagatggggg gatcgggggg ttgaagatgg ggtaggagtt       540
     tcgacagacg agaaaaagag tgaaaagaaa gaagagaaac tggcgaaaag gaaagatctg       600
     gaatggtga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page