(data stored in SCRATCH zone)

EMBL: AM920435.PC20G00930

AM920435.PC20G00930  Location/Qualifiers
FT   CDS_pept        complement(join(203251..205028,205095..205557))
FT                   /gene="Pc20g00930"
FT                   /locus_tag="PCH_Pc20g00930"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An17g02060 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g00930"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85422"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE3"
FT                   /protein_id="CAP85422.1"
FT                   /translation="MSTFPPPMAKPWDNDDGSDRPSTNSSNEHPEHAAHIRSRSTAHAH
FT                   SPKRLSVFSGRSRSNTTTSTSSRRSPGSSMTSTDSSIASDERAGSSLGLRSDKQDKPSR
FT                   SFLARGSRILRRQGSKINIVATLDEEDEADREKARPEREMFGRRARHADHSERLKSIIS
FT                   DPFDFHHLTHTNPSQFQSLDQTRENDLVTEFSAIRASQRPQTDLKGIRAEDIHFRNFSS
FT                   DDLGSLGTATTVDVPSISPPASPKTRQYPAHHARRESRVNENFSRPVSRYPRSCPTTPP
FT                   PPAVPETPPPETDEPAPRAIDEILGLSTAMTYPDLQSVQPTRFFSPEPADNSARTSSMS
FT                   SHYDLEDVPEEEEGTRYWESPESSMGCPHSRTTSQASQPPANAQSPSTSERKAPMSIYV
FT                   AEELSRKFSEAMGSPTLPQPPHDKDTPRAQVEVTPPEPIASLHQFSYEDELYDSWDADI
FT                   DYCYEHAAESTSNFDWSRTSLDEARPQIGVACSDGPWLAPKTRQLQPSPLSTSALATPD
FT                   LDPSPAQSMPSQLAPTPSTTDYEQDFIARGADYFHPVSSSILPSMGKQISHEPLYEEYM
FT                   TTDGESDRHFPFAQGMMGPISPRSSFSPISKCNSQESLMLSRAASIVRKHRSSVSTTNS
FT                   VPELVHSLSSSRELMPTDRMTAVEALTRPASSSHHRQTKSLAEAHFRQSGSSTSLEGPD
FT                   LTVSVHDRAKSISEVESQPTKFEAPLPPVPVRNPNRRKARSPSYSLFPTTAH"
     atgtcgacct ttccaccccc aatggctaaa ccctgggaca acgacgacgg cagtgaccgt        60
     ccgtccacga actcgtccaa cgagcaccca gaacatgccg cacatatccg ctccaggtcc       120
     actgcccacg ctcatagccc caagcgtctg tccgtcttca gcggtcgttc aagaagcaat       180
     accactacct cgacatcttc acgccggtca ccgggttctt ctatgacatc gacagatagt       240
     tcaatcgcct ctgacgagcg agccggttcg tcattgggac tccgctccga taagcaggac       300
     aagccgtccc ggtccttttt ggcgcgggga agccgcatcc tgcgtcgaca gggtagcaag       360
     atcaacatcg tcgccacgct ggacgaggaa gatgaggccg atcgtgagaa ggcacggcct       420
     gagagagaga tgtttggccg tcgcgcccgc catgccgatc acagcgagcg tttgaaaagc       480
     atcatttcgg atccttttga cttccatcat ttgactcata ccaacccctc gcagttccag       540
     tctttggatc aaacacgcga gaatgacctc gtcaccgagt tctcggccat ccgagcatct       600
     caacggcccc agaccgatct taaaggtatc cgtgctgagg acattcattt ccgtaatttc       660
     tccagtgatg acttgggctc gcttggaact gccaccacgg tggatgtgcc cagtataagc       720
     ccaccggctt cccccaaaac acgccagtac cccgcacacc acgcacgcag agagtctcgc       780
     gtcaacgaga acttctcgcg gccagtctcc agatatcccc gatcctgtcc caccactccc       840
     ccacctcctg ctgtgccgga gacccccccg cctgagactg atgaaccggc gccccgtgcc       900
     attgacgaga tcctgggctt gtccactgcg atgacgtacc cagaccttca atcggtgcag       960
     ccaacccggt ttttcagccc cgagcctgcg gacaacagcg ccaggacctc ctccatgagc      1020
     agccactatg atttggaaga tgtccccgag gaagaggaag gaacccggta ttgggaaagc      1080
     ccagagtcca gcatgggatg cccccattct cgcacaactt ctcaggccag ccaacctcca      1140
     gccaatgcgc agtcacccag caccagcgag cgcaaagctc caatgtcgat ctatgtggcc      1200
     gaggagcttt ctaggaagtt ctctgaggcg atgggctcgc cgactctccc tcaacctcct      1260
     cacgacaagg acactcctcg cgcccaggtg gaggtcacac ctcccgagcc gatcgccagc      1320
     ctgcaccaat tctcatacga ggatgaactg tatgactcgt gggacgcaga tatcgactac      1380
     tgctatgagc atgcagccga gtccacttcc aacttcgatt ggtctcgcac atccctggac      1440
     gaagcacgcc ctcaaatcgg tgtagcctgc agcgatggcc cctggctcgc cccaaagacc      1500
     cgacagctcc agccgagccc actgagcacc tccgccctcg cgaccccaga cctggaccct      1560
     agcccagcgc agtcgatgcc ctcccaatta gcccctaccc cctcaaccac agactatgag      1620
     caggatttca tcgcgcgggg cgcagactac ttccatcccg tcagttcctc gatcctcccg      1680
     tcaatgggca aacaaatctc ccacgaaccg ttgtacgagg agtacatgac gactgatggc      1740
     gaatcagacc gccacttccc cttcgcgcag ggtatgatgg gccccatctc gccacgcagc      1800
     agcttctccc cgataagcaa atgcaactcg caggagagcc tgatgctctc tcgcgcagcc      1860
     tccatcgtgc gcaagcaccg ctcctccgtc tcgacaacga acagcgtccc agagcttgtc      1920
     cacagcttgt ccagtagccg cgagctcatg ccgacagacc gcatgacagc cgtcgaggca      1980
     ctcacacgcc ctgcgtcatc ctcccaccac cgccagacca agagtctcgc cgaggcgcac      2040
     ttccgccaaa gtggcagcag cacgagcctc gagggcccgg atctcaccgt gtcggttcat      2100
     gaccgcgcca aatccatttc ggaggtcgag tcccagccca caaaattcga ggctcctttg      2160
     cctcctgtcc ctgtcagaaa cccgaaccgg aggaaggctc gctcaccatc ttactctctc      2220
     ttccccacaa ccgctcattg a                                                2241
//

If you have problems or comments...

PBIL Back to PBIL home page