(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01000

AM920435.PC20G01000  Location/Qualifiers
FT   CDS_pept        join(224159..224229,224374..224644)
FT                   /gene="Pc20g01000"
FT                   /locus_tag="PCH_Pc20g01000"
FT                   /note="Title: weak similarity to poly(ADP-ribose)
FT                   glycohydrolase - Bos taurus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01000"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85429"
FT                   /db_xref="GOA:B6HGR4"
FT                   /db_xref="InterPro:IPR007724"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR4"
FT                   /inference="similar to AA sequence:TREMBL:BTU78975.1"
FT                   /protein_id="CAP85429.1"
FT                   /translation="MADGPPWTKYCMTDQGQRLTGATGNTRKPYSFVTTGLWGCGAFGG
FT                   NRQVKAIIQWYAASLANVLELRYVLGGEEQKVFRDVFDVLVRLGTDLQNGKAAVPKPDE
FT                   IFEYVLQSL"
     atggcagatg ggcctccttg gacgaaatat tgcatgacag accaaggcca acgtctgact        60
     ggcgcaaccg ggaatacccg gaaaccctac tcctttgtta ctactggact ttggggctgc       120
     ggcgcctttg ggggaaatag acaggttaag gcgataatcc agtggtacgc tgcatcccta       180
     gcaaatgtgc tagagcttcg atatgtccta ggtggggaag agcagaaagt atttagagat       240
     gtctttgacg tgcttgtccg tctgggtaca gacctccaga atgggaaagc cgctgttccc       300
     aagccagatg agattttcga atatgtttta caaagcctgt ag                          342
//

If you have problems or comments...

PBIL Back to PBIL home page