(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01030

AM920435.PC20G01030  Location/Qualifiers
FT   CDS_pept        complement(231386..231958)
FT                   /gene="Pc20g01030"
FT                   /locus_tag="PCH_Pc20g01030"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   cipA - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01030"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85432"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR7"
FT                   /inference="similar to AA sequence:TREMBL:ENI344256.1"
FT                   /protein_id="CAP85432.1"
FT                   /translation="MRTGPTRKTIADLGKSSFWYEWSLAIPSAFGIDFAKRTVTLFDEG
FT                   EAMISTSTWPQVGRTVAGLLSMPIKAERGNGACLENLKNQVVYADPFTVSQKNMFESAF
FT                   RVTGTTEKDWTITKESAKERYENGVKEMNQGDRIEFVKILDTRIFFEDGAGNFESKGTL
FT                   NGLLGLPKEDIDEVTRAAIERSKSTTW"
     atgcgtacag gaccgactcg caaaaccata gctgatctcg gcaagagctc cttctggtat        60
     gaatggagtc tggccattcc atcggcgttc ggcatagact ttgccaagcg tactgtgaca       120
     ttattcgacg aaggtgaggc catgatttcg acttcgacct ggcctcaggt tggccggact       180
     gttgctggtc ttctcagcat gccaatcaag gctgaaaggg gcaacggggc ttgcctcgag       240
     aacttgaaga accaggttgt gtatgctgat cctttcactg ttagccaaaa gaatatgttc       300
     gagtctgctt tccgggttac cgggaccaca gagaaggact ggactattac aaaggaatca       360
     gctaaggaga ggtatgagaa tggtgtgaag gagatgaatc agggtgaccg cattgagttt       420
     gttaagatat tggatacgag aatcttcttc gaggatggcg cgggtaattt tgaatccaag       480
     ggcacactga atggcttgct tggcttgcca aaggaggata ttgatgaagt gaccagggca       540
     gctatcgagc gctcgaagag caccacttgg tag                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page