(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01050

AM920435.PC20G01050  Location/Qualifiers
FT   CDS_pept        complement(join(233199..233652,233711..233858,
FT                   233922..233995,234069..234114,234256..234306,
FT                   234385..234397))
FT                   /gene="Pc20g01050"
FT                   /locus_tag="PCH_Pc20g01050"
FT                   /note="Title: strong similarity to protein Rvs161
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01050"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85434"
FT                   /db_xref="GOA:B6HGR9"
FT                   /db_xref="InterPro:IPR003005"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR037429"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR9"
FT                   /inference="similar to AA sequence:PIR:S19516"
FT                   /inference="protein motif:PFAM:PF03114"
FT                   /protein_id="CAP85434.1"
FT                   /translation="MSWAGFKKNVNRATTQVMMKTGHVERTNDRDYEIEERRYRTMETA
FT                   ATRLQKESKGYLDSLRAMTASQMRIAETIDAFYGDAGTKDGVSRSYKQAVEDLDAETIK
FT                   ALDGPYRTTVLDPISRFCAYFPDVNECIKKRNHKLLDYDAMRAKVKKLAEKPDKDVTKL
FT                   PRTEREAEMAKQAYEQLNEQLFNELPQLIDLRVPYLDPSFEALVKIQLRFCAEAYSRMA
FT                   QVQQYLDAETRDQYAKGDLDNRVEEVLQEIRDLSIAGTV"
     atgtcttggg cagggttcaa gaaaaatgtc aaccgtgcga cgacgcaggt gatgatgaag        60
     acgggccatg tcgagagaac gaatgatcgc gattatgaga ttgaggaacg tcgttaccgg       120
     actatggaga ccgcggcaac tcggttgcaa aaggaatcca agggatatct ggattcacta       180
     cgagccatga cggcctccca aatgcgcatt gcggagacca ttgatgcttt ctacggcgac       240
     gcgggcacaa aggatggtgt gagccggagc tacaagcagg ccgttgagga tcttgatgcc       300
     gagaccatca aagctctgga tgggccatac cgtactaccg ttctcgaccc catctcccga       360
     ttctgcgcct acttccccga cgtgaacgaa tgcatcaaga aacgcaacca caagctgcta       420
     gactacgacg ccatgcgcgc caaggtcaag aagctagccg agaagcccga caaggacgtg       480
     accaagctgc cacggaccga acgcgaagcc gagatggcca agcaggccta cgagcagctg       540
     aatgagcagc tcttcaacga actcccccag cttatcgacc tacgtgtgcc ttacctcgac       600
     cccagcttcg aagctctcgt caagatccag ctgcgcttct gtgccgaggc gtactcacga       660
     atggcacagg tgcagcagta tctcgatgcc gagactcgcg accagtatgc caagggtgat       720
     ctggataacc gggttgagga ggtgttgcag gagatccgcg atttgagcat agctggaacc       780
     gtttga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page